KEGG   Sus scrofa (pig): 100520490
Entry
100520490         CDS       T01009                                 

Gene name
GLI1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04024  cAMP signaling pathway
ssc04340  Hedgehog signaling pathway
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100520490 (GLI1)
   04024 cAMP signaling pathway
    100520490 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100520490 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100520490 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100520490 (GLI1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    100520490 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 zf-C2H2_8
Other DBs
NCBI-GeneID: 100520490
NCBI-ProteinID: NP_001243522
Ensembl: ENSSSCG00000000443
UniProt: H6WJF7
LinkDB
Position
5
AA seq 1106 aa
MFNSMTPPPVSSYGDPCCLRPLPSQGAPSMGTEGLPGVPFCHQATLMSGPHSYGPARETN
SCTEAPLFPPPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCASPGGS
YGHLSIGTMSPSLGFSPQMNQQKGATPSFGVQPCGPHDPTPGGMMLHPQSRGPLPTCQLK
SELDVLVSKCPEEPLEGDMSSPNSTGTQDPLLGMLDGREDPEREEKPEPDSVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRASALSTVEPKRERDG
GPVREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQFRPVGPRGLKLPSLTHTGTPVSRRLGPPVSLD
RRSSSSSSVSSAYTVSRRSSLASPFPPGSPPENGASSLPGLTPAQHYLLRARYASARGGG
TPPTAAPSLDRMGGLPAPPWRSRAEYPGYNPNVGVTRRASDPARAADRPAPARVQRFKSL
GCVHTSPTVAGGGQNFDPHLPTSVYSPQPPSITENVTMDTRGLREKPEVGTSMMGSGLNP
YMDFPPADTLGYGGPEGAATESYGVRGPGSLPLGPGPPTNYGPNPCPQQVAYPEPTPETW
GEFPSHSGLYPGPKAPAGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPNEG
PTCPQPLYSHYPQPPPPQYPQSGTYTQPPPDYLPSEPRPGLEFESPTHSTGQLKAQLVCN
YVQSQQELLWEGGGRGDPPVQEPLYQSSKFLGGSQVSPSPARAPVATYGPGFAPNLPSHK
SGSYPTPSPCHENFAVGANKASHRAAALPRLLPPLPTCYGPLKAGGTNPSCGHPEVGRLG
GGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPLPSHDQRDSSEHTPPPSGP
PNMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccgccagtcagtagctatggcgatccctgctgtctccgg
cccctccccagtcagggggctcccagcatggggacagaaggactgcctggtgtgcccttc
tgccaccaggccaccctcatgtctggtccccacagttatgggccagctagagagaccaac
agctgcaccgaggccccactgtttcctcctccccggagtgcagtcaagttaaccaagaag
cgggccctctccatctcacctctgtcggacgccagcctggacctacagacagttatccga
acctcccccagctccctcgtggccttcatcaactcacgttgtgcatctccagggggctcc
tatggtcacctctccatcggcaccatgagcccatctttgggattctcacctcagatgaat
cagcaaaaaggggccacgccttccttcggggtccagccctgtggtccccatgaccccacc
ccaggggggatgatgctgcatcctcagtcccggggacccctcccaacttgccagctgaag
tctgagctggatgtgctggtgagcaagtgccccgaggagcccttggaaggtgatatgtcc
agccccaactccacgggcacacaggatcccctgttggggatgctagatgggcgcgaagat
ccagagagagaggagaagcctgaacctgactctgtgtatgagaccgattgccgctgggac
ggctgcagtcaggaatttgactcccaggagcagctggtgcaccacatcaacagcgaacac
atccatggagaacggaaggaattcgtgtgccattgggggggctgctccagggagctgagg
cccttcaaagcccagtacatgctggtggtgcacatgcgcaggcacacgggcgagaagcca
cacaagtgcacgtttgaggggtgccggaaatcatactcacgcctggaaaatctgaagaca
cacctgcggtcacacacgggtgagaagccatacatgtgtgagcatgagggctgcagtaaa
gccttcagcaacgccagtgaccgagccaagcaccagaatcggacccactccaatgagaag
ccgtatgtgtgtaagctccctggctgcaccaaacgctacacagatcccagctcgctccgg
aaacatgtcaagacagtgcacggtcctgatgcccacgtgaccaagcggcaccgaggagat
ggccccctgcctcgggcctcggctctttccacggtggagcctaagagggagcgggatgga
ggccccgtcagggaggagagcagactgactgtgccagagggtgccatgaagccacagccg
agtcctggagcccagtcctcctgcagcagtgaccactccccagcaggcagcgcggccaat
acagacagcggtgtggaaatgactggaaatgcaggaggcagcactgaggacctgtccagc
ttggacgagggaccttgtattgctggcactggtctgtctactcttcgccgccttgagaat
ctcaggctggaccaactacatcagttccggccagtggggccccggggcctcaaactgccc
agcttgacccacactggcactcccgtgtcccgccggctgggccccccagtttctcttgac
cgccgcagcagcagctccagcagtgtcagctcagcctatactgtcagtcgccgctcctcc
ttggcctctcctttcccccctggctccccaccagagaatggggcatcctctctgcctggc
ctcacacctgcccagcactacctgctccgggcaagatatgcttcagccaggggaggtggt
accccacccacagcagcacccagcctggatcggatggggggtctccctgcacctccctgg
agaagccgagccgagtatccaggatacaaccccaacgtaggggtcacccggagggccagt
gacccagcccgggctgctgaccgccctgccccagctagagtccagcggttcaagagcttg
ggttgtgtccacacatcccctacagtggcaggaggaggacagaacttcgatccccatctc
ccaacctctgtctactcaccacagccccccagcatcactgagaatgtcaccatggatacc
agagggctacgggagaagccagaggttgggacctccatgatgggcagtggtctgaaccct
tatatggatttcccacctgctgatactctgggatacgggggacctgagggggcagcaact
gagtcttacggagttagaggcccgggctccctgcctcttgggcctggtccacccaccaac
tatggccccaacccttgccctcagcaggtcgcctatcctgaacccaccccagaaacatgg
ggtgaattcccttcccactctggactgtacccaggccccaaggcgcctgctggaacctac
agccagtgtcctcgtcttgaacactatggacaagtgcaggtgaagccagaacaggggtgt
ccagtgggttctgactccacaggactggcaccctgcctcaatgcccaccccaatgagggg
cctacctgcccacagcctctatactcccactacccccagcctccccctccccagtacccc
cagtcaggcacctatacccagccacctcctgactatcttccttcagagcccaggcccggc
ctggagtttgagtcccctactcattctacaggacagctcaaggctcagcttgtgtgtaat
tatgttcagtctcaacaggaactgctgtgggagggcggtggaaggggagatcccccagtc
caggaacctctctaccagagttccaagtttctggggggttcccaggttagcccgagccct
gccagagccccagtggccacatacggacctggctttgcacctaacctgcccagtcacaag
tcaggctcctatcctaccccttcaccatgccatgaaaattttgcagtcggggcaaacaag
gcttcccacagggcagcagcactaccccgacttctgcccccgctacccacttgctacggg
cccctcaaggcagggggcaccaaccccagctgtggccatcccgaggtgggcaggctggga
gggggccctgccttgtaccctcctccggaagggcaggtgtgtaaccctctggactctctc
gatctcgacaacactcagctggactttgtggctattctggatgagccccaggggctgagt
cctctgccttctcatgatcagagggacagctctgaacacaccccacctccctcggggccc
cccaacatggctgtgggcaacatgagtgtcttattgggatccctacctggggagacacaa
tttctcaattccagtgcctga

DBGET integrated database retrieval system