KEGG   Sus scrofa (pig): 100520726
Entry
100520726         CDS       T01009                                 

Gene name
EGR1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04371  Apelin signaling pathway
ssc04912  GnRH signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05020  Prion disease
ssc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100520726 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100520726 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    100520726 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100520726 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100520726 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100520726 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100520726 (EGR1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100520726 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Cornifin Zf_RING zf-BED zf-H2C2_5 zf-C2H2_8
Other DBs
NCBI-GeneID: 100520726
NCBI-ProteinID: XP_003124022
Ensembl: ENSSSCG00000014336
Vega: OTTSUSG00000002555
UniProt: F1RH73
LinkDB
Position
2
AA seq 542 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGG
NSNSSSSSGGGGGGGGSSNSSSSSAFNPQGEAGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPATSSSAPSPAASS
SSSASQSPPLSCAVQSNDSSPIYSAAPTFPTPNTDIFPEPQGQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVASAAASSLPSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSYSSPGSST
YPSPVHSGFPSPSVATTYASVPPAFPTQGSSFPSSAVTNSFSASTGLSDMATTFSPRTIE
IC
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggcggcagccaaggccgagatgcagctgatgtccccactgcagatctccgaccccttc
ggctcctttccacattcgcccaccatggacaactaccctaagctggaggagatgatgctg
ctgagcaatggggctccccagttcctcggtgccgccggagcccccgagggcagcggcggt
aacagcaacagcagcagcagcagcgggggcggtggaggtggagggggcagcagcaacagc
agcagcagcagcgccttcaaccctcagggggaggcgggcgagcagccctacgagcacctg
accgcagagtcttttcccgacatctctctgaataacgagaaggttctagtggagacgagt
taccccagccaaaccactcggctgccccccatcacctacactggccgcttctctctggag
cctgcacccaacagtggcaacaccttgtggcctgagcccctcttcagcctggtcagtggg
ctcgtgagcatgaccaatccggccacctcgtcctcagcaccatctccagcggcctcttcc
tcctcttctgcctcccagagcccacccctgagctgcgcagtgcaatccaacgacagcagc
cccatttactcagcggcacccaccttccccacacctaatactgacatcttccccgagcca
cagggccaggcctttccaggctcagcaggcaccgcacttcagtacccacctcctgcctac
cctgctgccaagggtggcttccaggtccccatgatccctgactatctgtttccacaacag
cagggggacctgggcctgggcaccccagaccagaagcctttccagggtctggagagccga
acccagcagccttcgctcactccactctctactatcaaggcctttgccacgcagtcgggc
tcccaggacctgaaggccctcaacaccacctaccagtcccagctcatcaagcccagccgc
atgcgcaagtaccccaaccggcccagcaagacacccccccacgaacgcccctacgcctgc
ccggtggagtcctgcgaccggcgcttctcccgctcagatgagctcacccgccacatccgc
atccacacgggccagaaacccttccagtgccgcatctgcatgcgcaacttcagccgcagt
gaccacctcaccacccacatccgcacccacacgggcgagaagcccttcgcctgtgacatc
tgtgggagaaagtttgccaggagcgatgaacgcaagaggcataccaagatccacttgcgg
cagaaggacaaaaaagcagacaaaagtgtggcctcggcggccgcgtcctctctcccttcc
tacccgtccccggtggctacctcctacccgtccccggtcactacctcttacccttcccca
gcgaccacctcatacccgtcgcccgtgcccacctcctactcctctcccggctcctcgacc
tacccatcccctgtgcacagtggtttcccatcaccctcggtggccaccacgtacgcctcg
gttcctcctgctttccccacccagggcagcagctttccttcctcagctgtcaccaactcc
ttcagcgcctccacagggctttcggacatggcgacaaccttttctcccaggacaattgaa
atctgctaa

DBGET integrated database retrieval system