KEGG   Sus scrofa (pig): 100521065
Entry
100521065         CDS       T01009                                 

Gene name
BAD
Definition
(RefSeq) LOW QUALITY PROTEIN: bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04140  Autophagy - animal
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04370  VEGF signaling pathway
ssc04510  Focal adhesion
ssc04722  Neurotrophin signaling pathway
ssc04910  Insulin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc05010  Alzheimer disease
ssc05014  Amyotrophic lateral sclerosis
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05165  Human papillomavirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100521065 (BAD)
   04014 Ras signaling pathway
    100521065 (BAD)
   04370 VEGF signaling pathway
    100521065 (BAD)
   04024 cAMP signaling pathway
    100521065 (BAD)
   04022 cGMP-PKG signaling pathway
    100521065 (BAD)
   04151 PI3K-Akt signaling pathway
    100521065 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100521065 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    100521065 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100521065 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100521065 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100521065 (BAD)
   04919 Thyroid hormone signaling pathway
    100521065 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100521065 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100521065 (BAD)
   05203 Viral carcinogenesis
    100521065 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100521065 (BAD)
   05212 Pancreatic cancer
    100521065 (BAD)
   05225 Hepatocellular carcinoma
    100521065 (BAD)
   05221 Acute myeloid leukemia
    100521065 (BAD)
   05220 Chronic myeloid leukemia
    100521065 (BAD)
   05218 Melanoma
    100521065 (BAD)
   05211 Renal cell carcinoma
    100521065 (BAD)
   05215 Prostate cancer
    100521065 (BAD)
   05213 Endometrial cancer
    100521065 (BAD)
   05223 Non-small cell lung cancer
    100521065 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100521065 (BAD)
   05014 Amyotrophic lateral sclerosis
    100521065 (BAD)
   05020 Prion disease
    100521065 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    100521065 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100521065 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100521065 (BAD)
   05161 Hepatitis B
    100521065 (BAD)
   05160 Hepatitis C
    100521065 (BAD)
   05162 Measles
    100521065 (BAD)
   05168 Herpes simplex virus 1 infection
    100521065 (BAD)
   05165 Human papillomavirus infection
    100521065 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100521065 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100521065 (BAD)
   01524 Platinum drug resistance
    100521065 (BAD)
   01522 Endocrine resistance
    100521065 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 100521065
NCBI-ProteinID: XP_020938542
Ensembl: ENSSSCG00000013033
LinkDB
Position
2
AA seq 169 aa
MFQIPEFEQSEQEDSSPADRGLGPSPTGTXPPGPSKPWRTAPGHLGEAGHQQGQPASSSH
HGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELRRMSD
EFQGSFKKGLPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ
NT seq 510 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactccagccctgcagacagg
ggcctgggccccagccccacagggacangacccccaggccccagcaagccctggcgcacg
gccccaggccacctgggggaagctggtcaccagcaggggcagccggccagcagcagccac
catggaggcgctggggctgtggagacccggagtcgccacagctcttacccagaggggacc
gaggaggatgaagggactgaggatgaggagctcagccccttccgcggccgatcgctctcg
gcgccccccatcctctgggctgcacagcgttatggccgcgagctccggaggatgagtgac
gagttccagggttccttcaagaagggacttcctcgcccgaagagcgcgggcacagcgacg
cagatgcggcaaagccccagctggaagcgcttcctccagtcctggtggtaccggaactcg
gggagaggaggccccgccccctcccaatga

DBGET integrated database retrieval system