KEGG   Sus scrofa (pig): 100521394Help
Entry
100521394         CDS       T01009                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc00030  Pentose phosphate pathway
ssc00051  Fructose and mannose metabolism
ssc00052  Galactose metabolism
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc01230  Biosynthesis of amino acids
ssc03018  RNA degradation
ssc04152  AMPK signaling pathway
ssc05230  Central carbon metabolism in cancer
Module
ssc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100521394 (PFKP)
   00030 Pentose phosphate pathway
    100521394 (PFKP)
   00051 Fructose and mannose metabolism
    100521394 (PFKP)
   00052 Galactose metabolism
    100521394 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100521394 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100521394 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100521394 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100521394 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ssc03019]
    100521394 (PFKP)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100521394 (PFKP)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100521394 (PFKP)
Messenger RNA biogenesis [BR:ssc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100521394 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100521394
NCBI-ProteinID: XP_020920725
Ensembl: ENSSSCG00000011158
LinkDB All DBs
Position
10
AA seq 791 aa AA seqDB search
MAHHDDSQNPKGSFRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYF
IYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCKDFRSREGRLKAAANLIQLGI
TNLCVIGGDGSLTGANIFRREWSGLLEELAKDGKIDKEAVQRHGHLNVVGMVGSIDNDFC
GTDMTIGTDSALHRIMEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQEDMCIKLSENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLME
CVQMTQDVQKAMDEGRFKEAVKLRGRSFESNLNTYKRLAMKLPDSQIPKTNCNVGVVNVG
APAAGMNAAVRAAVRVGISDGHKMFAVYDGFEGFAKGNIKEIGWADVGGWTGQGGSILGT
KRTLPGKYLEDIAAQMRAHRINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATV
SNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGFCGYLANMGALAAG
ADAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGR
GVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISSKLKESLGKGKRFVSDDSICV
LGISKRNLVFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKASFEVSEAGQLEPV
QHRGPEEPAAI
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccacgacgactcccagaaccccaagggttccttccgaaagttcctggagcac
ctctccggggcgggcaaagccatcggcgtgctgaccagcggcggggatgcccaagggatg
aacgctgctgtccgagccgtcgtccgcatgggcatatacgtgggggccaaggtgtacttt
atctacgagggttaccagggcatggtggatggcggcagcaacatcgtcgaggcggactgg
gagagcgtgtccagtatcctgcaagtgggagggacgatcattggcagcgcccgctgcaaa
gacttccgctctcgggaaggccgcctgaaagctgctgctaacctgatccagctgggcatc
accaacctgtgtgtcatcggtggggacggcagcctcacgggggccaatatcttccggaga
gagtggagcgggctgctggaggagctggccaaggatggcaagatcgacaaggaggcagtg
cagagacatgggcacctcaacgtggtggggatggtgggctccattgacaacgacttctgt
ggcaccgacatgaccatcggcaccgactcggccctgcaccgcatcatggaggtggtagat
gccatcatgaccaccgcccagagccaccagaggaccttcgttctggaggtcatgggccgg
cactgcgggtacctggccctggtgagcgccttggcctgcggggccgactgggtgttcctt
ccggagtcgccgccagaggaaggctggcaggaagacatgtgcatcaagctctcggagaac
cgcgcccggaaaaaacggctgaatatcatcattgtggccgagggagccatcgacactcag
aacaaacccatcacctcggagcagatcaaggagctcgtggtcacgcagctgggttacgac
acgcgggtaaccatcctcggacacgtgcagaggggcgggacaccttcagcctttgacagg
atcttggccagccgcatgggtgtggaggccgtggtcgccctcctccaggccaccccggag
accccagcctgcgtggtgtcgctgagcgggaaccaggcggtgcggctgccgctgatggag
tgcgtgcagatgacccaggatgtccaaaaggcgatggacgaggggagatttaaggaggcc
gtgaagctccgaggaaggagcttcgagagcaacctgaacacctacaagcggctggccatg
aagctgcctgactcccagatcccaaagaccaactgcaacgtgggcgtcgtgaacgtgggc
gcgcccgcggccggcatgaacgcggcagtgcgcgctgccgtgcgcgtgggcatctccgac
ggacacaagatgttcgccgtgtacgacggcttcgagggcttcgccaaaggcaacataaag
gaaatcggctgggccgatgttggaggctggaccggccaaggaggctccattcttgggaca
aaacgcacgcttcctgggaagtacctggaggacattgcggcgcagatgcgtgcccaccgc
atcaacgccctcctgatcatcggtgggttcgaggcctacctggggctgctggagctgtcg
gccgcccgggagaagcacgaggagttctgcgtccccatggtcatggttccggccaccgtg
tccaacaacgtcccgggctccgacttcagcatcggggccgacactgccctcaacactatc
accgacacgtgcgaccgcatcaagcagtcggcgagcgggaccaagcgccgcgtgttcatc
atcgagaccatgggcggcttctgcggctacctggccaacatgggggcgctggcggccggc
gccgacgccgcctacatcttcgaggagcccttcgacatccgggacctgcagtccaacgtg
gagcacctgacggagaagatgaaaaccaccatccagagggggctcgtgctcaggaacgag
agctgcagcgagaactacaccaccgacttcatctaccagctctactcggaggagggcagg
ggggtgttcgactgcaggaagaacgtgctgggccacatgcagcagggtggggcgccttct
ccgtttgatagaaacttcggaaccaaaatttcggccagagccatgcagtggatcagctcg
aagctgaaggagtctctggggaaaggaaaaagattcgtgagcgatgattccatctgcgtg
ctgggaatcagcaaacgaaaccttgtcttccaacctgtggcggagctgaagaaggagacg
gacttcgagcacaggatccccaaggagcagtggtggctcaagctgcggcccctcatgaag
atcctggccaagtacaaggccagcttcgaggtgtcggaggccggccagctggagcccgtg
cagcaccgcggccccgaggagcccgccgccatctag

DBGET integrated database retrieval system