KEGG   Sus scrofa (pig): 100521638
Entry
100521638         CDS       T01009                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X1
  KO
K08015  Ras association domain-containing protein 5
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04218  Cellular senescence
ssc04670  Leukocyte transendothelial migration
ssc05200  Pathways in cancer
ssc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100521638 (RASSF5)
   04015 Rap1 signaling pathway
    100521638 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100521638 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100521638 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100521638 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100521638 (RASSF5)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 PHD
Other DBs
NCBI-GeneID: 100521638
NCBI-ProteinID: XP_020918974
LinkDB
Position
9
AA seq 409 aa
MAMASPAIGQRPYRLLLDPEPPRYLPSLSGPEPPPPPPGPSSRRCAPAPLSTAPEAHEGR
GARRAARGDVESQPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELALRSGRGWCDLCGREVLRQALRCANCKFTCHPECRSLIQLDCSQQEGSSQDR
PSPESTLTATFSQNVCKPVEEPRCPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSVADCPLYLRLLAGPDTDVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEP
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggccatggcgtccccggccatcgggcagcgcccgtaccggctactcttggacccggaa
ccgccgcgctatctgccgagcctgagcggccccgagccgccaccgccacccccgggcccg
tcctcgcgccgctgcgcccccgcgcccctgtccactgcgcctgaggcgcacgaggggcgc
ggcgcccggagggctgctcgaggagacgtggagtcccagcctcgcgcctcccgacccgct
cgccctctccggcctggtctgcagcagagactgcggcggcggcctggagcgccccggccc
cgagacgtgcggagcatcttcgaacagccacaggatccccgcgtcccggcggagcgaggc
gaggggcactgctttgccgaactggcgctgcggagcggccggggctggtgtgacctgtgc
ggacgagaggtgctgcggcaggcgctgcgctgcgctaactgcaaattcacctgccaccct
gagtgccgcagcctgatccagctggactgcagtcagcaggaaggctcctcccaggacaga
ccctctccagaaagcaccctcactgcaaccttcagccagaatgtctgcaaacccgtggag
gagccgaggtgcccgcccacgctgcaggagatcaagcagaagattgacagctacaacacc
cgggagaagaattgcctgggcatgaagctgagtgaagacggcacctacacgggtttcatc
aaagtgcatctgaaactccggcggccagtgacggtacctgctgggataaggccccagtcc
atctatgacgccatcaaagaagtgaacctggcggccaccacggacaagcggacctccttc
tacctgccactcgatgccatcaagcagctacacatcagcagcaccaccacggtcagtgag
gtcatccaggggctgctcaagaagttcatggtcgtggataatccccagaagtttgcactt
tttaagcggatacacaaggatgggcaagtgctcttccagaagctctcggttgctgactgt
cccctctacctgcgcttgcttgcggggcctgacacggatgtgctcagctttgtgctaaag
gagaacgaaactggagaggtggagtgggacgccttctccatccccgagctccagaacttc
ctaacaatcctggaaaaagaagagcaggataaaatccagcaagtgcaaaagaagtatgac
aagtttaggcagaaattagaggagccttaa

DBGET integrated database retrieval system