KEGG   Sus scrofa (pig): 100521736
Entry
100521736         CDS       T01009                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X3
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04024  cAMP signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04137  Mitophagy - animal
ssc04140  Autophagy - animal
ssc04141  Protein processing in endoplasmic reticulum
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04217  Necroptosis
ssc04310  Wnt signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04530  Tight junction
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04723  Retrograde endocannabinoid signaling
ssc04728  Dopaminergic synapse
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04917  Prolactin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04926  Relaxin signaling pathway
ssc04930  Type II diabetes mellitus
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05161  Hepatitis B
ssc05162  Measles
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05231  Choline metabolism in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100521736 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100521736 (MAPK10)
   04012 ErbB signaling pathway
    100521736 (MAPK10)
   04014 Ras signaling pathway
    100521736 (MAPK10)
   04310 Wnt signaling pathway
    100521736 (MAPK10)
   04668 TNF signaling pathway
    100521736 (MAPK10)
   04068 FoxO signaling pathway
    100521736 (MAPK10)
   04071 Sphingolipid signaling pathway
    100521736 (MAPK10)
   04024 cAMP signaling pathway
    100521736 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100521736 (MAPK10)
   04137 Mitophagy - animal
    100521736 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    100521736 (MAPK10)
   04215 Apoptosis - multiple species
    100521736 (MAPK10)
   04217 Necroptosis
    100521736 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100521736 (MAPK10)
   04530 Tight junction
    100521736 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100521736 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100521736 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100521736 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100521736 (MAPK10)
   04660 T cell receptor signaling pathway
    100521736 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100521736 (MAPK10)
   04659 Th17 cell differentiation
    100521736 (MAPK10)
   04657 IL-17 signaling pathway
    100521736 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100521736 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100521736 (MAPK10)
   04920 Adipocytokine signaling pathway
    100521736 (MAPK10)
   04912 GnRH signaling pathway
    100521736 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100521736 (MAPK10)
   04917 Prolactin signaling pathway
    100521736 (MAPK10)
   04926 Relaxin signaling pathway
    100521736 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    100521736 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    100521736 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100521736 (MAPK10)
   04722 Neurotrophin signaling pathway
    100521736 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100521736 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100521736 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100521736 (MAPK10)
   05231 Choline metabolism in cancer
    100521736 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100521736 (MAPK10)
   05212 Pancreatic cancer
    100521736 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100521736 (MAPK10)
   05012 Parkinson disease
    100521736 (MAPK10)
   05016 Huntington disease
    100521736 (MAPK10)
   05017 Spinocerebellar ataxia
    100521736 (MAPK10)
   05020 Prion disease
    100521736 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    100521736 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100521736 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100521736 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    100521736 (MAPK10)
   04931 Insulin resistance
    100521736 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100521736 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100521736 (MAPK10)
   05135 Yersinia infection
    100521736 (MAPK10)
   05133 Pertussis
    100521736 (MAPK10)
   05152 Tuberculosis
    100521736 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100521736 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    100521736 (MAPK10)
   05161 Hepatitis B
    100521736 (MAPK10)
   05171 Coronavirus disease - COVID-19
    100521736 (MAPK10)
   05162 Measles
    100521736 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100521736 (MAPK10)
   05169 Epstein-Barr virus infection
    100521736 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100521736 (MAPK10)
   05142 Chagas disease
    100521736 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100521736 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100521736 (MAPK10)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100521736 (MAPK10)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100521736 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100521736
NCBI-ProteinID: XP_003129389
Ensembl: ENSSSCG00000009228
Vega: OTTSUSG00000001581
LinkDB
Position
8
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMLSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagccgattggctctggggctcagggaatagtttgtgct
gcctatgacgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaactcatgccaagagagcttaccgggagctggtcctcatgaaatgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaagacgctggaggagtttcaa
gatgtttacttagtgatggaactgatggatgccaacttgtgtcaggtgattcagatggag
ttagaccatgagcgaatgtcttacctgctataccaaatgttatgtggcatcaagcacctt
cactctgctgggattattcacagggacttaaaaccaagtaacattgtagtcaagtctgat
tgtacactgaaaatcctggactttggcctggccaggacagcaggcacaagcttcatgatg
actccttatgtggtgacacgttattacagggcccccgaggtcattctaggaatgggctac
aaggaaaatgtggatatatggtctgtgggatgcattatgggagaaatggttcgtcacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgagcagctggga
acgccatgtccagaattcatgaagaaattacaacccacggtaagaaactatgtggagaat
cgacccaagtacgcaggactcaccttccccaagctcttcccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaaggatatcagtggatgacgccttacagcatccgtatatcaat
gtctggtacgaccctgctgaagtggaggcgcctccgcctcagatatatgacaaacagctg
gatgagagagaacacaccatcgaagaatggaaagaactcatctacaaggaggtgatgctt
tcggaagagaagacgaagaacggcgtcgtgaaaggccagccctctccctcaggtgcagca
gtgaacagcagtgagagtctccctccttcctcttctgtcaacgacatctcctccatgtcc
accgaccagaccctggcatccgacactgacagcagcctggaagcctcggcgggacccctg
ggttgttgcaggtga

KEGG   Sus scrofa (pig): 396609
Entry
396609            CDS       T01009                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X4
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04024  cAMP signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04137  Mitophagy - animal
ssc04140  Autophagy - animal
ssc04141  Protein processing in endoplasmic reticulum
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04217  Necroptosis
ssc04310  Wnt signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04530  Tight junction
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04723  Retrograde endocannabinoid signaling
ssc04728  Dopaminergic synapse
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04917  Prolactin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04926  Relaxin signaling pathway
ssc04930  Type II diabetes mellitus
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05161  Hepatitis B
ssc05162  Measles
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05231  Choline metabolism in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    396609 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396609 (MAPK9)
   04012 ErbB signaling pathway
    396609 (MAPK9)
   04014 Ras signaling pathway
    396609 (MAPK9)
   04310 Wnt signaling pathway
    396609 (MAPK9)
   04668 TNF signaling pathway
    396609 (MAPK9)
   04068 FoxO signaling pathway
    396609 (MAPK9)
   04071 Sphingolipid signaling pathway
    396609 (MAPK9)
   04024 cAMP signaling pathway
    396609 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    396609 (MAPK9)
   04137 Mitophagy - animal
    396609 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    396609 (MAPK9)
   04215 Apoptosis - multiple species
    396609 (MAPK9)
   04217 Necroptosis
    396609 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396609 (MAPK9)
   04530 Tight junction
    396609 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    396609 (MAPK9)
   04621 NOD-like receptor signaling pathway
    396609 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    396609 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    396609 (MAPK9)
   04660 T cell receptor signaling pathway
    396609 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    396609 (MAPK9)
   04659 Th17 cell differentiation
    396609 (MAPK9)
   04657 IL-17 signaling pathway
    396609 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    396609 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    396609 (MAPK9)
   04920 Adipocytokine signaling pathway
    396609 (MAPK9)
   04912 GnRH signaling pathway
    396609 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    396609 (MAPK9)
   04917 Prolactin signaling pathway
    396609 (MAPK9)
   04926 Relaxin signaling pathway
    396609 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    396609 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    396609 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    396609 (MAPK9)
   04722 Neurotrophin signaling pathway
    396609 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    396609 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    396609 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396609 (MAPK9)
   05231 Choline metabolism in cancer
    396609 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    396609 (MAPK9)
   05212 Pancreatic cancer
    396609 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    396609 (MAPK9)
   05012 Parkinson disease
    396609 (MAPK9)
   05016 Huntington disease
    396609 (MAPK9)
   05017 Spinocerebellar ataxia
    396609 (MAPK9)
   05020 Prion disease
    396609 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    396609 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    396609 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    396609 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    396609 (MAPK9)
   04931 Insulin resistance
    396609 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    396609 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396609 (MAPK9)
   05135 Yersinia infection
    396609 (MAPK9)
   05133 Pertussis
    396609 (MAPK9)
   05152 Tuberculosis
    396609 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    396609 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    396609 (MAPK9)
   05161 Hepatitis B
    396609 (MAPK9)
   05171 Coronavirus disease - COVID-19
    396609 (MAPK9)
   05162 Measles
    396609 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    396609 (MAPK9)
   05169 Epstein-Barr virus infection
    396609 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    396609 (MAPK9)
   05142 Chagas disease
    396609 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    396609 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    396609 (MAPK9)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     396609 (MAPK9)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   396609 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 396609
NCBI-ProteinID: XP_003354219
Ensembl: ENSSSCG00000014010
Vega: OTTSUSG00000002881
UniProt: F1S5Q3
LinkDB
Position
2
AA seq 382 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARELLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERNKNGVVKDQPSAQMQQ
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgatagtcagttttacagtgtgcaagtggcagattcaactttc
actgtcctaaaacgttaccagcagttgaaaccaattggctctggagctcaaggaattgtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaactcatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactttagaagaa
ttccaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcat
atggagttggatcatgaaagaatgtcctaccttctttaccaaatgctctgtggtattaaa
catctgcattcagctggtataattcatagagatttgaaacctagcaacattgtagtaaaa
tcagattgcacccttaagattcttgactttggcctggcccgcacagcatgcaccaacttt
atgatgaccccctatgtggtgacacggtattatcgggcaccagaagtcatcctgggcatg
ggctataaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgagcag
ctaggaacaccatctgcagagttcatgaagaaacttcagccgactgtgaggaattatgta
gaaaacagaccaaagtatccaggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatctgaacgagacaaaattaaaacaagtcaagccagagaattattatcaaaa
atgttagtgatagatcctgacaaacgaatctctgtagatgaagctttgcgtcacccttat
attactgtttggtatgaccctgctgaagcagaagcgccaccacctcagatttatgatgcc
cagttggaagaaagagaacatgccattgaagaatggaaagagctaatttacaaagaagta
atggattgggaagaaagaaacaagaatggtgttgtaaaagatcaaccttcagcacagatg
cagcagtaa

KEGG   Sus scrofa (pig): 396610
Entry
396610            CDS       T01009                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04024  cAMP signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04137  Mitophagy - animal
ssc04140  Autophagy - animal
ssc04141  Protein processing in endoplasmic reticulum
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04217  Necroptosis
ssc04310  Wnt signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04530  Tight junction
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04723  Retrograde endocannabinoid signaling
ssc04728  Dopaminergic synapse
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04917  Prolactin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04926  Relaxin signaling pathway
ssc04930  Type II diabetes mellitus
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05161  Hepatitis B
ssc05162  Measles
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05231  Choline metabolism in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    396610 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396610 (MAPK8)
   04012 ErbB signaling pathway
    396610 (MAPK8)
   04014 Ras signaling pathway
    396610 (MAPK8)
   04310 Wnt signaling pathway
    396610 (MAPK8)
   04668 TNF signaling pathway
    396610 (MAPK8)
   04068 FoxO signaling pathway
    396610 (MAPK8)
   04071 Sphingolipid signaling pathway
    396610 (MAPK8)
   04024 cAMP signaling pathway
    396610 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    396610 (MAPK8)
   04137 Mitophagy - animal
    396610 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    396610 (MAPK8)
   04215 Apoptosis - multiple species
    396610 (MAPK8)
   04217 Necroptosis
    396610 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396610 (MAPK8)
   04530 Tight junction
    396610 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    396610 (MAPK8)
   04621 NOD-like receptor signaling pathway
    396610 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    396610 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    396610 (MAPK8)
   04660 T cell receptor signaling pathway
    396610 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    396610 (MAPK8)
   04659 Th17 cell differentiation
    396610 (MAPK8)
   04657 IL-17 signaling pathway
    396610 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    396610 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    396610 (MAPK8)
   04920 Adipocytokine signaling pathway
    396610 (MAPK8)
   04912 GnRH signaling pathway
    396610 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    396610 (MAPK8)
   04917 Prolactin signaling pathway
    396610 (MAPK8)
   04926 Relaxin signaling pathway
    396610 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    396610 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    396610 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    396610 (MAPK8)
   04722 Neurotrophin signaling pathway
    396610 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    396610 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    396610 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396610 (MAPK8)
   05231 Choline metabolism in cancer
    396610 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    396610 (MAPK8)
   05212 Pancreatic cancer
    396610 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    396610 (MAPK8)
   05012 Parkinson disease
    396610 (MAPK8)
   05016 Huntington disease
    396610 (MAPK8)
   05017 Spinocerebellar ataxia
    396610 (MAPK8)
   05020 Prion disease
    396610 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    396610 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    396610 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    396610 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    396610 (MAPK8)
   04931 Insulin resistance
    396610 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    396610 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396610 (MAPK8)
   05135 Yersinia infection
    396610 (MAPK8)
   05133 Pertussis
    396610 (MAPK8)
   05152 Tuberculosis
    396610 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    396610 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    396610 (MAPK8)
   05161 Hepatitis B
    396610 (MAPK8)
   05171 Coronavirus disease - COVID-19
    396610 (MAPK8)
   05162 Measles
    396610 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    396610 (MAPK8)
   05169 Epstein-Barr virus infection
    396610 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    396610 (MAPK8)
   05142 Chagas disease
    396610 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    396610 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    396610 (MAPK8)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     396610 (MAPK8)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   396610 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 396610
NCBI-ProteinID: XP_001929201
Ensembl: ENSSSCG00000010380 ENSSSCG00000024187
Vega: OTTSUSG00000002880
UniProt: A0A480EHQ8
LinkDB
Position
14
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAFDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattc
actgtcctgaaacggtatcagaatttaaaaccaataggctcaggagctcaaggaatagta
tgtgcagcttttgatgccattcttgaaagaaatgttgcaatcaagaagttaagccggcca
tttcagaatcagactcatgctaagcgtgcttacagagagctagttcttatgaaatgtgta
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagttatggagctcatggatgcaaatctttgtcaagtgattcag
atggaactagatcatgaaagaatgtcttaccttctctatcagatgctttgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtggtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcaatggaataaagttattgaacag
cttggaacaccatgtcccgaattcatgaagaaactacaaccaacagtaaggacttacgtc
gaaaacagacctaaatatgctggatatagctttgagaagctctttcctgatgtacttttc
ccagccgattcggagcacaacaaacttaaagctagtcaggcaagggatttgttatccaaa
atgctggtaattgatgcatctaaaaggatctctgtagatgaagctctccagcacccttac
attaatgtctggtatgatccttctgaagctgaagctccaccaccaaagatacctgacaag
cagttggatgaaagggaacacacaatagaagagtggaaagaattgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

DBGET integrated database retrieval system