KEGG   Sus scrofa (pig): 100521789Help
Entry
100521789         CDS       T01009                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00500  Starch and sucrose metabolism
ssc01100  Metabolic pathways
ssc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100521789
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100521789
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100521789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100521789
NCBI-ProteinID: XP_003125929
Ensembl: ENSSSCG00000025216
LinkDB All DBs
Structure
PDB: 

Position
4
AA seq 511 aa AA seqDB search
MKLFLLLSAFGFCWAQYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPP
NENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGS
GAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGL
LDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAG
SRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWA
RNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQP
FANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGI
KVYVSSDGTAQFSISNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtttctgctgctttcagcctttgggttctgctgggcccagtatgccccacaa
acccagtctggacgaacgtctattgtccatctgtttgaatggcgctgggttgacattgct
cttgaatgtgagcggtatttgggccccaaaggatttggaggggtacaggtctcccccccc
aatgaaaatatagtagtcactaacccttcaagaccttggtgggagagataccaaccagtg
agttacaagttatgtaccagatcaggaaatgaaaatgaattcagagatatggtgactaga
tgtaacaacgttggcgtgcgtatttatgtggatgctgtcattaatcatatgtgtggaagt
ggtgcagctgcaggaacgggcaccacttgtggaagttattgcaaccctggaaacagggag
tttccagcagtcccatactctgcttgggattttaacgatggtaaatgtaaaactgcaagt
ggaggaatcgagagctataatgatccttatcaagtcagagattgtcaactggttggtctt
cttgatcttgcactggaaaaagattatgtgcgctccatgattgctgattatctaaacaaa
ctcattgacattggtgtagcagggttccgaattgatgcttctaagcacatgtggcctgga
gacataaaagcagttttggataaacttcacaacctaaacaccaactggttccctgccgga
agtcgacctttcatattccaggaggtgattgatttgggtggtgaggcaattcaaagcagt
gagtactttggaaatggccgcgtgacagaatttaaatacggtgcaaaactgggcaccgtt
gtgcgcaagtggagtggagagaagatgtcttacttgaagaactggggagaaggctggggt
ttcatgccctctgatagagcccttgtctttgttgataaccatgacaaccagcgagggcat
ggagcagggggagcatctattcttacattctgggacgctagactgtacaaagtggcagtt
ggatttatgctcgcccacccttacggattcacacgagtgatgtcaagctaccgttgggca
agaaattttgtgaatggacaagatgttaatgattggattgggccaccaaataataacggg
gtcattaaggaagttactattaatgcagatactacctgtggcaatgactgggtctgtgag
catcgatggcgtcagataaggaacatggtttggttccgtaacgtggtggacggccaacct
tttgcaaactggtgggataacggaagcaaccaggtagcttttggaagaggaaacagagga
ttcattgtctttaacaatgatgattggcaattatcttcaactttgcaaactggtcttcct
ggtggcacatactgtgatgttatctctggagataaagttggtaacagttgtacaggaatt
aaagtctatgtttccagtgatggcacagctcagttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgaatccaaattgtaa

DBGET integrated database retrieval system