KEGG   Sus scrofa (pig): 100521870Help
Entry
100521870         CDS       T01009                                 

Gene name
OGDHL
Definition
(RefSeq) LOW QUALITY PROTEIN: 2-oxoglutarate dehydrogenase-like, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00020  Citrate cycle (TCA cycle)
ssc00310  Lysine degradation
ssc00380  Tryptophan metabolism
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
Module
ssc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100521870 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    100521870 (OGDHL)
   00380 Tryptophan metabolism
    100521870 (OGDHL)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     100521870 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 100521870
NCBI-ProteinID: XP_020928655
Ensembl: ENSSSCG00000010394
LinkDB All DBs
Position
14
AA seq 1011 aa AA seqDB search
MNQVRLLPSRLGAQASRLLAPHGVQRFSWCSRSSGPPATFPSSRVGGGSSYMEEMYFAWL
ENPQSVHKSWDSFFRKASEEASYGLAQPRPPSVVPESRPAASGRTKTSKLVEDHLXVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLQEADLDKEFQLPTTTF
IGGSEHTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEXKRT
LLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRG
RLNVLANVIRKDLEQIFCQFDPKLEAATRWGSGDVKYHLGMYHERINRVTNRNITLSLVA
NPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSY
TTNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAE
WRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTL
QEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPED
VLTHIGEVASSVPLEDFKIHTGLSRILRGREDMTRKRTVDWALAEYMAFGSLLKEGIHVR
LSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGY
AMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSS
ARPERFLQMSNDDSDAYPAFTQDFEVRQLYDCNWIVVNCSXPANYFHVLRRQILLPFRKP
LIIFTPKSLLRHPEAKSSFDQWYQGTSFQRVIPEDGAAVRAPEQVQRLIFCTGKVYYDLV
KERSNQGLDEQVAITRLEQISPFPFDLIKQEAEKYPGAELVWCQEEHKNMGYYDYISPRF
MTILGRARPIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFDGKTF
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggtgcggctgctgccttcccggcttggggcacaggcctcgaggcttctggcc
ccacatggtgtccagaggttcagctggtgcagcaggtcatctgggccaccggccaccttc
ccaagcagcagagttggaggtggctccagttacatggaggagatgtacttcgcctggttg
gaaaacccccagagtgtccacaagtcctgggacagcttcttccggaaagccagtgaggaa
gcctcttatggcctggctcagccccggcccccttctgtcgtccctgagagcaggccagca
gcatctggccggaccaagaccagcaagctggtggaggatcacctgngcgtgcagtccctg
atccgggcctaccagatccgaggccaccatgtggcccaactggaccccctgggcattctg
gatgcagacctggattcctttgtgccctcagacttaatcacaaccattgataaattggcc
ttctatgacctgcaggaggctgacctggataaggagttccagctgcccacaactactttt
attggaggctctgagcacaccctttctctgcgagagatcattcggcgcctggagagcaca
tactgccagcacattggtctggagttcatgttcatcaatgacgtggaacagtgccagtgg
attcggcagaagtttgagacccctggtgtgatgcagttctccagcgagngaaagcggacc
ctgctggcccggctggtgcgctccatgagatttgaagactttctggcccggaaatggtcc
tcagagaagcggtttggcctggagggctgtgaggtcatgattcctgccctcaagaccatc
atcgacaaatccagtgagatggggatcgagaatgtcatcctggggatgccccacaggggc
aggctgaatgtgctggccaacgtcatccgcaaggacctggagcagatcttctgccagttt
gaccctaagctggaggcggcgacgaggtggggctctggagatgtcaaataccacctcggc
atgtaccacgagaggatcaaccgggtcacaaacaggaacatcactctgtcactcgtggcc
aacccatcccatctggaagctgtggacccggtggtgcagggaaagacaaaggcagagcag
ttctaccgcggggacgcccagggcaagaaagtcatgtccatcctggtccatggggatgcc
gccttcgccggccagggcgtagtctacgagaccttccatctgagcgacctgccctcttac
accaccaacggcactgtgcacgtcgttgtcaacaaccagattggcttcaccacagacccc
cggatggcccgctcttccccataccccaccgatgtggcccgcgtggtcaacgcacccatc
ttccacgtgaacgcagacgacccagaggccgtgatatacgtgtgcagcgtggcagctgag
tggaggaacactttcaataaagacgtcgtggtggatctggtctgttatcgcaggcgtggc
cacaacgagatggatgagcccatgttcacacagccactcatgtacaagcagatccacaga
caggtgcctgtgctgaagaagtatgcagacaagctcatcgctgagggcacagtcaccctg
caggaattcgaggaagaaatcgccaaatatgaccggatctgtgaggaggcatatggccgg
tccaaggataaaaagatcctgcatatcaaacactggctggattccccctggcctggcttc
ttcaatgtggacggtgagcccaagagcatgacatgcccagccacgggcattcctgaggat
gtgctgacccacattggtgaagtggccagctctgtgcccctggaagactttaagatccac
acaggcctctctcggatcctgcggggccgtgaggacatgaccaggaagaggacagtggac
tgggcgctcgcggaatacatggccttcggctccctgctcaaggagggcatccacgtgcgg
ctcagtgggcaggacgtggagaggggcacgttcagtcaccggcaccacgttctccatgac
caggaagttgaccggaggacgtgtgtcccgatgaaccacctctggcctgaccaggccccc
tacaccgtgtgcaacagctccctctcggagtacggagtcctgggcttcgagctgggctat
gccatggccagccccaacgccctggtcctctgggaggcgcagtttggtgacttccacaac
acagcccagtgcatcatcgaccagttcatcagcacaggccaggccaagtgggtgcggcac
aacggcatcgtgctgctgctgccccacggcatggagggcatgggcccggagcactcgtcg
gcgaggcctgagaggttcctgcagatgagcaatgatgactcggatgcctaccccgcattc
acccaggacttcgaggtgaggcagctctatgactgcaactggattgtggtcaactgctcc
nacccggccaactacttccacgtgctgcgccggcagatcctgctgcccttccgcaagccg
ctgatcatcttcacacctaaatctctgctgaggcacccagaggccaagtccagctttgac
caatggtatcaggggaccagctttcagcgggtgattcctgaggatggggctgcggtacgg
gctcctgagcaggtgcaacggctcatcttctgcacgggaaaggtgtactacgacctggtg
aaggagcggagcaaccagggcctggatgagcaggtggccatcacacgccttgagcagatc
tctccattcccctttgacctgatcaagcaagaggcagagaagtacccaggcgctgagctg
gtgtggtgccaggaggagcataagaacatgggctactacgactacatcagcccacgcttc
atgaccatcctgggccgggcaaggcccatatggtatgttggccgagacccagcagctgca
ccggccacgggaaacaggaacactcacctggtgtctctgaagaagtttctggatactgcc
ttcaatctccaggcctttgacggcaagacattttag

DBGET integrated database retrieval system