KEGG   Sus scrofa (pig): 100522002
Entry
100522002         CDS       T01009                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04510  Focal adhesion
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04921  Oxytocin signaling pathway
ssc05140  Leishmaniasis
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05213  Endometrial cancer
ssc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100522002 (ELK1)
   04012 ErbB signaling pathway
    100522002 (ELK1)
   04014 Ras signaling pathway
    100522002 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100522002 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100522002 (ELK1)
   04912 GnRH signaling pathway
    100522002 (ELK1)
   04921 Oxytocin signaling pathway
    100522002 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100522002 (ELK1)
   05205 Proteoglycans in cancer
    100522002 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100522002 (ELK1)
   05213 Endometrial cancer
    100522002 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100522002 (ELK1)
   05161 Hepatitis B
    100522002 (ELK1)
   05163 Human cytomegalovirus infection
    100522002 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100522002 (ELK1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100522002 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 100522002
NCBI-ProteinID: XP_013846342
Ensembl: ENSSSCG00000012279
Vega: OTTSUSG00000004540
UniProt: K7GQA4 A0A4X1T8E2
LinkDB
Position
X
AA seq 443 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSAEDCPAQPEVAVTSAVASAGPAAVH
AVPGDTASGKPGTPKGAGMAGPGGLARSSRNDYMRSGLYSTFTIQSLQPQPQPPASHPRP
STVLPNATPAGAAVPPSGSRSTSPSPLEACLEAEEASLPLQVILTPPEAPNLKSEEPNME
PGLGRPLPPEVKVEEPKEELEAAASGEAGFVLEAVKAEPFEPKAEPEIPPAEGVPARLPA
VLMETAAQVGGLAASTTSSTEIAQPQKGRKPRDLELPLSPSLLGGPGSERTPGSGTGSGL
QAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQV
HIPSISVDGLSTPVVLSPGPQKP
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggacccttctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaggcaac
ggccacatcatctcctggacctcacgggatggcggtgagttcaagctggtggatgccgag
gaggtggcccggctgtgggggctgcgcaagaataagaccaacatgaattatgacaagctc
agccgggccttgcggtactactatgacaagaacatcatccgcaaagtgagcggccagaag
tttgtctacaagtttgtgtcctaccccgaggtcgcagggtgctccgcggaggactgccca
gcccagcccgaggtggctgtcacctccgcggtggcaagtgcaggccccgccgctgtccac
gccgttcccggggacactgcctccggaaagccaggcacacccaagggtgccggaatggca
ggcccgggcggcttggcacgcagcagccggaacgactacatgcgctcaggcctctactcc
accttcaccatccagtccctacagccgcagccacagccgccagcctctcacccgcggcct
tccaccgtgctccccaacgccaccccagcgggagcagcagtgcccccctcagggagtagg
agcaccagtccaagccccttggaggcctgtctggaggctgaggaggccagcctgcctctg
caggtcatcctgaccccgcctgaggccccaaaccttaaatccgaagagccaaatatggag
cctgggttgggccggccactgcccccggaagtgaaagtggaagagcccaaggaagagtta
gaagctgcagccagtggggaggcaggatttgtgctggaagccgtcaaggccgagcccttt
gagcccaaggcagagccagaaatcccgcccgcagagggcgtgccagcccggctgcctgcg
gtccttatggaaaccgcagcgcaggtgggcggccttgcggcttccaccacttccagcaca
gagatcgcccagcctcagaagggccggaagccccgggacctggagcttccactcagcccg
agcctgctgggtgggccgggatccgaacggactccaggatcgggaaccggctccgggctg
caggcgccaggcccggcgctgacgccgtccctgctacctacgcacacattgaccccggtg
ctgctgacgcccagctcgctgccccccagcattcacttctggagcaccctgagtcccatt
gcaccccgtagcccggccaagctctccttccagtttccgtccagtggcagcgcccaggtg
cacatcccttccatcagcgtggatggcctctcaacccccgtggtgctctccccagggccc
cagaagccatga

DBGET integrated database retrieval system