KEGG   Sus scrofa (pig): 100522267
Entry
100522267         CDS       T01009                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: multidrug resistance protein 1-like
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc02010  ABC transporters
ssc04976  Bile secretion
ssc05206  MicroRNAs in cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100522267
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100522267
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100522267
  09162 Cancer: specific types
   05226 Gastric cancer
    100522267
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    100522267
   04147 Exosome [BR:ssc04147]
    100522267
   04090 CD molecules [BR:ssc04090]
    100522267
Enzymes [BR:ssc01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     100522267
Transporters [BR:ssc02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    100522267
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100522267
CD molecules [BR:ssc04090]
 Proteins
  100522267
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase AAA_16 Rad17 Zeta_toxin AAA_22 RsgA_GTPase G-alpha AAA AAA_5 AAA_29 AAA_7 AAA_15 PRK DUF815 APS_kinase AAA_30 NTPase_1 DUF2207
Other DBs
NCBI-GeneID: 100522267
NCBI-ProteinID: XP_013845043
LinkDB
Position
9
AA seq 1296 aa
MFFSKNDEKKEKKPAVSVFAMFRYSNWLDVLYMLLGTTAAIVHGAGLPLMMLVFGEMIDS
FASVGNLAHIKIPNVTSGSEYCSWYWFYWKCEEISVTMNEVCGALTKYALVYSVLYRTCA
VFLLFFRYAYYYSAIGAGVLVAAYIQVLFWCLAAGRQIYKIRKRFFHAIMQQEIGWFDMH
DVGELNTRLTDDISKINNGIGDKIGVFFXLLATFVIGFIVAFSRGWKLTLVILTITPVLG
LSVAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIITVIAFGGQKKDLERYNKNLEEAKR
IGIKKAITANMSIGAAFLLIYASYALAFWYGXTLVLSNEYTIGQVITVFYSVLTGAFSIG
QASPSIEAFANARGAAYEIFKIIDSKPSIDSYSKNGHKPDNIKGNLEFRNVHFSYPSRNE
VKILKGLNLKVESGQTVALVGNSGCGKSTTVQLMQRLYDPTEGVVSIDGQDIRTINVRYL
REIIGVVSQEPVLFATTIAENIRYGRENVTMEEIEKAVKEANAYDFIMKLPNKFDTLVGE
RGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKAREGQTTIVIA
HHLSTVRNAYVIAGFDDGVIVEKGSHDELMKERGVYFKLFTMQVXTKSSAMKLENAVGEA
DVLDMSPRDFGSSLIRRSTLKSVKGPQGQDRKLSTKESLDEHVPPVSFWRILKLNITEWP
YFVVGIFCAIINGGLQPAFSIIFSRMIGVFTRNDDRETKRQHSNMFSLLFLMLGIISFIT
FFLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAARVKGAI
GARLAVITQNIANLGTGIIISFIYGWQLTLLLLVIVPIIAIAGVVEIKMLSGQALKDKKE
LEGAGKIATEAIENFRTVVSLTREEKFESMYDQSLQIPYSNSLRKAHIFEITFSITQAVM
YFSNAACFQFCAYLVQHGHMDFQDVLLVFXAIVYGVMAIGHIDSFAPDYAKAKVSAARVI
TIIEKVPLIDSYSTTGLQLNTVEGNLTFNEVVFNYPXRPDIPVLQGLSLEVKKGQTLALV
GSSGCGKSTVVQLLERFYDPLAGKVLIDGKEIKELNVQWLRAHMGIVSQEPILFDCSIAE
NIACGDNSWVVSQEEIVQAAKEANIHPFIETLPDKYNTRVGDKGTQLSGGQKQRIAIARA
LVRQPLILLLDEATSALDTQSEKVVQEALDKAREGCTCIVIAHRLSTIQNTDLIVVIQNG
KVREHGTHQQLLAQKGIYFSMVSVQAGAKRSSTVTI
NT seq 3891 nt   +upstreamnt  +downstreamnt
atgtttttcagtaaaaatgatgaaaagaaagaaaagaaaccagctgtcagtgtttttgcc
atgtttcgctattcgaactggcttgatgtgttgtatatgttgctggggactacggctgcc
atcgtgcacggagctggactgcccctcatgatgctggtttttggagaaatgatagatagc
ttcgcaagtgtaggaaatttggcacacataaaaattcccaatgtaactagtggaagtgag
tattgttcctggtactggttttattggaagtgtgaagaaatatcagtcactatgaatgaa
gtttgtggagctcttactaaatatgcactagtgtattcagtgctgtacagaacctgtgca
gtgttcttattgtttttcaggtacgcctattattacagtgccattggtgctggcgtgctt
gttgctgcttacatccaggttttgttctggtgcctggcagccggaagacaaatatacaaa
atcagaaaacgtttttttcatgctatcatgcagcaggagataggctggtttgatatgcat
gatgttggggagcttaacacccggctcacagatgacatctccaaaattaataatggaatt
ggtgacaaaattggagtgttcttttagttactagcaacgttcgtcattggttttatagta
gcattttcacgtggttggaagctgactcttgtgattctgaccatcactcctgttcttggt
ctgtcagttgctgtctgggcaaagatactgtcttcatttactgataaagaactcttggcc
tatgcaaaagctggagcagtagctgaagaggtcttagcagccattataactgtgattgca
tttggaggacaaaagaaagatcttgaaaggtataacaaaaatttggaagaagccaaaagg
attggaataaagaaagctattacagccaacatgtctattggtgccgctttcctgttgatt
tatgcatcctatgccctggcattctggtatgganccaccttggtcctctcaaatgaatat
actattggacaagtaatcactgtcttctattctgtgttaactggggcttttagtattgga
caggcctctccaagcatcgaggcatttgcaaatgcaagaggagcagcttatgaaatattc
aaaatcattgatagcaagccaagcattgacagctattcgaagaatggacacaaaccagat
aacatcaagggaaatctggaattcagaaacgttcacttcagttacccatctcgaaatgaa
gttaagatcttgaaggggctcaacttgaaggtagagagcgggcagacagtggccctggtc
gggaacagcggctgtgggaaaagcacgacggtccagctgatgcagaggctctatgacccc
acggagggcgtggtcagtattgacggacaggacatcaggacgatcaacgtaaggtatctg
cgggaaattatcggcgtggtgagccaggagcccgtgctctttgccaccacgatagctgag
aacattcgctatggccgggaaaatgtcaccatggaagagattgagaaagctgtgaaggaa
gccaacgcctatgactttatcatgaaactgcctaacaaatttgacaccctggttggagag
agaggggcccagctgagtggtggacagaagcagagaatcgccatcgctcgggccctggtt
cgtaacccgaagatcctcctgctggatgaggccacgtcagcgctggacacggagagtgaa
gcggtggttcaggtggccctggataaggccagagaaggccagaccaccattgtgatagcc
catcatttgtccacagttcgcaatgcttatgtcattgctggttttgatgatggagtcatt
gtggagaaaggcagtcatgatgaactcatgaaggagagaggcgtttacttcaaacttttc
acaatgcaggtatagactaagtctagtgcaatgaaattagaaaatgcagttggtgaagct
gatgtcttggacatgtctccaagagattttggatctagtctaataagaagatcaactctc
aagagtgttaagggacctcaaggccaagacagaaagcttagtacaaaagagagcttggat
gaacacgtacctccagtttccttttggaggattctgaagctgaatataactgaatggcct
tattttgtggttggcatattttgtgccattataaacggaggtctgcaaccagcattttca
ataatattttcaaggatgataggggtttttacaagaaatgatgatcgtgaaaccaaacga
cagcatagtaacatgttttcactcttgtttctaatgcttggaattatttcttttattaca
ttcttccttcagggcttcacgtttggcaaagccggagagatcctcaccaagaggctgcgg
tacatggttttcaggtccatgctgagacaggatgtgagctggttcgatgaccctaaaaac
accacgggagcattgacgaccaggcttgccaatgatgctgctcgagttaaaggggctatt
ggtgccaggcttgctgtcattacccagaatatagcaaatcttgggacaggcattattata
tccttcatctatggctggcaattaacacttttactcttggtgattgtacccatcattgca
atagcaggagttgttgaaattaaaatgctgtctggacaagcactgaaagataagaaagag
ctagaaggtgccgggaagattgccactgaagcaatagaaaacttccgaactgttgtttct
ttgactcgggaggagaagtttgaatctatgtatgaccagagcttgcagataccatacagt
aactctttgaggaaggcacacatctttgaaatcactttttccatcacccaggcagtgatg
tatttttctaacgctgcctgtttccagttttgtgcctacttggtacaacatggccacatg
gactttcaggatgttctcttagtcttctaagctattgtctatggtgtcatggccataggg
cacatcgattcatttgctcctgactatgccaaagccaaagtgtcggcagcccgtgtcatc
acgatcattgaaaaggtccctctgattgacagctacagcaccacaggcctacagctgaat
accgtggaaggaaatctgacatttaatgaagttgtgttcaactacccanctcggccagac
atcccagtgcttcaggggctgagcctggaggtaaagaagggccagaccctggccttggtg
ggcagcagcggctgtgggaagagcacggtggtccagctcctggagcggttctacgacccc
ttggctggaaaagtgctaattgacggcaaggagattaaagaactgaacgtccagtggctc
cgagcacacatgggcattgtgtcccaggagcccatcctgtttgactgcagcattgctgag
aacatcgcctgtggggacaacagctgggtcgtgtctcaggaggagatcgtgcaggcggcc
aaggaggccaacatccaccccttcatcgagacactgcctgataaatataacaccagagtg
ggagacaaaggaacgcagctctctgggggccagaaacagcgcattgcaatagctcgtgcc
cttgtcagacagcctcttattttgcttctggatgaagctacatcggctctggatacacaa
agtgaaaaggttgtccaagaagccctggacaaagccagagaaggctgcacctgcatcgtg
atcgctcaccgcctgtccactatccagaacacagacttgatcgtggtgattcagaacggc
aaagtccgggagcatggcacacaccagcagctactggcacagaaaggcatctatttctcc
atggtcagcgtccaggctggagcaaagcgttcatcaactgtgaccatatga

KEGG   Sus scrofa (pig): 100522455
Entry
100522455         CDS       T01009                                 

Definition
(RefSeq) multidrug resistance protein 1 isoform X1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc02010  ABC transporters
ssc04976  Bile secretion
ssc05206  MicroRNAs in cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100522455
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100522455
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100522455
  09162 Cancer: specific types
   05226 Gastric cancer
    100522455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    100522455
   04147 Exosome [BR:ssc04147]
    100522455
   04090 CD molecules [BR:ssc04090]
    100522455
Enzymes [BR:ssc01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     100522455
Transporters [BR:ssc02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    100522455
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100522455
CD molecules [BR:ssc04090]
 Proteins
  100522455
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 ABC_ATPase AAA_22 Rad17 Zeta_toxin RsgA_GTPase G-alpha AAA AAA_5 AAA_29 AAA_7 AAA_15 PRK DUF815 APS_kinase AAA_30 NTPase_1 DUF2207
Other DBs
NCBI-GeneID: 100522455
NCBI-ProteinID: XP_013845046
Ensembl: ENSSSCG00000026730
LinkDB
Position
9
AA seq 1281 aa
MDLEEGRNKGTGKKNFLKRDQKSKNDKKEKKPAVSVLAMFRYSNWLDVLYMLLGTTAAIV
HGTGLPLMMLVFGEMIDSFASVGNLAHIKIPNVTSGSLKNHTHFGCTLEEKVTKYAYYYS
AIGAGVLVAAYIQVSFWCMAAGRQIYKIRKQFFHAIMQQEIGWFDMHDVGELNTRLTDDI
SKINNGIGDKIGVFFQLLATFIIGFISAFSRGWKLALVVMTVSPILGLSVAVWAKILSSF
TDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAVTANISN
GATFLLIYASYALAFWYGTTLVLSNEYTIGQVITVFFSVLIGAFSIGQASPSIEAFANAR
GAAYEIFKIIDSKPSIDSYSKNGHKPDNIKGNLEFRNVHFSYPSRNEVKILKGLNLKVES
GQTVALVGNSGCGKSTTVQLMQRLYDPTEGVVSIDGQDIRTINVRYLREIIGVVSQEPVL
FATTIAENIRYGRENVTMEEIEKAVKEANAYDFIMKLPNKFDTLVGERGAQLSGGQKQRI
AIARALVRNPKILLLDEATSALDSESEAVVQVALDKAREGRTTIVIAHRLSTVRNADVIA
GFDDGVIVEKGSHDELMKEKGIYFKLVTVQTKGNEIELENAVDEADALDMSPKDFGSSLL
RRSTRKSIKGPQGQDRKLSTKEGLDEHVPPVSFWRILKLNITEWPYFVVGIFCAIINGGL
QPAFSIIFSRMIGVFTRNDDRETKRQHSNMFSLLFLMLGIISFITFFLQGFTFGKAGEIL
TKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAARVKGAIGARLAVITQNIANLG
TGIVMSFIFGWQLTLLLLVIVPVIAIAGVVEMKMLSGQAMTDKEELEGAGKIATEAIENF
RTVVSLTREEKFESMYDQSLQIPYSNSLRKAHIFGITFAITQAMMNFSYAICFRFGAYLV
QHGYMEFQDVLLVFSAIVYGAMAMGHVSSFAPDYAEAKVSAAHIIMIIEKTPLVDSYSTT
GLKPNTMEGNLTFNEVMFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLE
RFYDPLAGKVLIDGKEIKELNVQWLRAHMGIVSQEPILFDCSIAENIAYGDNSRVVSQEE
IVQAAKEANIHPFIETLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPLILLLDEATS
ALDTQSEKVVQEALDKAREGRTCIVIAHRLSTIQNADSIVVIQKGKVREHGTHQQLLAQK
GIYFSMVSVQAGTKHLSTVMI
NT seq 3846 nt   +upstreamnt  +downstreamnt
atggatcttgaagaaggccgaaacaaaggaacggggaagaagaacttcttaaaaagggac
caaaaaagtaaaaatgataagaaagaaaagaaaccagctgtcagtgttttggccatgttt
cgctattcgaactggcttgatgtgttgtatatgttgctggggactacggctgccatcgtg
cacggaactggactgcccctcatgatgctggtttttggagaaatgatagatagcttcgca
agtgtaggaaatttggcacacataaaaattcccaatgtaactagtggaagtcttaagaat
catacacattttggctgcacactggaggaaaaagtgaccaagtacgcctattattacagt
gccattggtgctggtgtgcttgttgccgcttacatccaggtttcgttctggtgcatggca
gccggaagacagatatacaaaatcagaaaacagttttttcatgctatcatgcagcaggag
ataggctggtttgatatgcatgatgttggggagcttaacacccggctcacagatgacatc
tccaaaattaataatggaattggtgacaaaattggagtgttctttcagttactagcaacg
ttcatcatcggttttatatcagcattttcacgtggttggaagctggctcttgtggttatg
accgtcagtcctattcttggtctgtcagttgctgtctgggcaaagatactgtcttcattt
actgataaagaactcttggcctatgcaaaagctggagcagtagctgaagaggtgttagcc
gccattagaactgtgattgcatttggaggacaaaagaaagaacttgaaaggtataacaaa
aatttggaagaagccaaaaggattggaataaagaaagctgttacagccaacatttctaat
ggtgccactttcctgttgatttatgcatcctatgccctggcattctggtatgggaccacc
ttggtcctctcaaatgaatatactattggacaagtaatcactgtcttcttttctgtgtta
attggggcttttagtattggacaggcctctccaagcattgaggcatttgcaaatgcaaga
ggagcagcttatgaaatattcaaaatcattgatagcaagccaagcattgacagctattcg
aagaatggacacaaaccagataatatcaagggaaatctggaattcagaaacgttcacttc
agttacccatctcgaaatgaagttaagatcttgaaggggctcaacttgaaggtagagagc
gggcagacggtggccctggtcggcaacagcggctgtgggaaaagcacgacggtccagctg
atgcagaggctctatgaccccacggagggcgtggtcagtattgacggacaggacatcagg
acgatcaacgtaaggtatctgcgggaaattatcggcgtggtgagccaggagcccgtgctc
tttgccaccacgatagctgagaacattcgctatggccgggaaaatgtcaccatggaagag
attgagaaagctgtgaaggaagccaacgcctatgactttatcatgaaactgcctaacaaa
tttgacaccctggttggagagagaggggcccagctgagtggtggacagaagcagagaatc
gccatcgctcgggccctggttcgtaacccgaagatcctcctgctggatgaggccacgtca
gcgctggactcggagagtgaagcagtggttcaggtggccctggataaggccagagaaggc
cggaccaccattgtgatagcccatcgtttgtccacagttcgcaatgccgatgtcattgct
ggttttgatgatggagtcattgtggagaaaggcagtcatgatgaactcatgaaggagaaa
ggcatttacttcaaacttgttacagtgcagacaaaaggcaatgaaatagaattagaaaat
gcagtggatgaagctgatgccttggacatgtctccaaaagatttcggatccagtctacta
agaagatcaactcgcaagagtatcaagggaccacaaggccaagacagaaagcttagtaca
aaagaaggcttggatgaacacgtacctccagtttccttttggaggattctgaagctgaat
ataactgaatggccttattttgtggttggcatattttgtgccattataaacggaggtctg
caaccagcattttcaataatattttcaaggatgataggggtttttacaagaaatgatgat
cgtgaaaccaaacgacagcatagtaacatgttttcactcttgtttctaatgcttggaatt
atttcttttattacattcttccttcagggcttcacgtttggcaaagccggagagatcctc
accaagaggctgcggtacatggttttcaggtccatgctgagacaggatgtgagctggttc
gatgaccctaaaaacaccacgggagcattgacgaccaggcttgccaatgatgctgctcga
gttaaaggggctattggtgccaggcttgctgtcattacccagaatatagcaaatcttggg
acagggattgttatgtccttcatcttcggctggcaactaacacttttactcttggtgatt
gtacccgtcattgcaatagcaggagttgttgaaatgaaaatgttatctggacaagcaatg
acagataaggaagagctagaaggtgcggggaagattgccactgaagcaatagaaaacttc
cgaactgttgtttctttgactcgggaggagaagtttgaatctatgtatgaccagagctta
cagataccatacagtaactctttgaggaaggcacacatcttcggaatcacttttgccatc
acccaggcaatgatgaatttttcttatgctatctgtttccggtttggcgcctacttggta
caacatggctacatggagtttcaggatgttctcttagtcttctcagctattgtctatggt
gccatggccatggggcacgtaagttcatttgctcctgactacgctgaagccaaagtgtct
gcagcccacatcatcatgatcattgagaagacccctctggttgacagctacagcaccaca
ggcctaaagccgaataccatggaaggaaatctgacatttaatgaagtcatgttcaactac
cccactcgaccagacatcccagtgcttcaggggctgagcctggaggtgaagaagggccag
accctggccttggtgggcagcagtggctgtgggaagagcacggtggtccagctcctggag
cggttctatgaccccctggctggaaaagtgctaattgacggcaaggagattaaagaacta
aatgtccagtggctccgagcacacatgggcatcgtgtcccaggagcccatcctgtttgac
tgcagcattgctgagaacatcgcctatggggacaacagccgggtcgtgtctcaggaggag
atcgtgcaggcggccaaggaggccaacatccaccccttcatcgagacactgcctgataaa
tataacaccagagtgggagacaaaggaacgcagctctctgggggccagaaacagcgcatt
gcaatagctcgtgcccttgtcagacagcctctcattttgcttctggatgaagctacatcg
gctctggatacacaaagtgaaaaggttgtccaagaagccctggacaaagccagagaaggc
cgcacctgcatcgtgatcgctcaccgcctgtccaccatccagaacgcagactcgatcgtg
gtgattcagaaaggcaaagtccgggagcatggcacacaccagcagctactggcacagaaa
ggcatctatttctccatggtcagcgtccaggctggaacaaagcacttatcaactgtgatg
atatga

KEGG   Sus scrofa (pig): 396910
Entry
396910            CDS       T01009                                 

Gene name
ABCB1
Definition
(RefSeq) ATP-binding cassette, sub-family B (MDR/TAP), member 1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc02010  ABC transporters
ssc04976  Bile secretion
ssc05206  MicroRNAs in cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    396910 (ABCB1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    396910 (ABCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    396910 (ABCB1)
  09162 Cancer: specific types
   05226 Gastric cancer
    396910 (ABCB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    396910 (ABCB1)
   04147 Exosome [BR:ssc04147]
    396910 (ABCB1)
   04090 CD molecules [BR:ssc04090]
    396910 (ABCB1)
Enzymes [BR:ssc01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     396910 (ABCB1)
Transporters [BR:ssc02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    396910 (ABCB1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396910 (ABCB1)
CD molecules [BR:ssc04090]
 Proteins
  396910 (ABCB1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 ABC_ATPase AAA_22 Rad17 Zeta_toxin RsgA_GTPase G-alpha AAA AAA_5 AAA_29 SbcCD_C AAA_7 PRK AAA_15 DUF815 APS_kinase AAA_30 NTPase_1 DUF2207 NEMP
Other DBs
NCBI-GeneID: 396910
NCBI-ProteinID: NP_001295175
Ensembl: ENSSSCG00000015390
Vega: OTTSUSG00000002311
UniProt: A0A0E3MY68
LinkDB
Position
9
AA seq 1286 aa
MDLEEGRIERAGKKNFLKRDKKSKNDKKEKKPAVSVFAMFRYSNWLDRLYMLLGTTAAII
HGAGLPLMMLVFGEMTDSFASIGNMGNLTFPNMIYANCVNCPDNSTTLEEKMTVYAYYYC
GIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDV
SKINEGVGDKIGMFFQSIATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAIWAKILSSF
TDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISI
GAAFLLIYASYALAFWYGTTLVLSNEYTIGQVLTVFFSVLIGAFSVGQASPSIEAFANAR
GAAYEIFKIIDSKPSIDSYSKNGHKPDNIKGNLEFRNVHFSYPSRNEVKILKGLNLKVES
GQTVALVGNSGCGKSTTVQLMQRLYDPTEGVVSIDGQDIRTINVRYLREIIGVVSQEPVL
FATTIAENIRYGRENVTMEEIEKAVKEANAYDFIMKLPNKFDTLVGERGAQLSGGQKQRI
AIARALVRNPKILLLDEATSALDTESEAVVQVALDKAREGRTTIVIAHRLSTVRNADVIA
GFDDGVIVEKGSHDELMKEKGVYFKLVTMQTKGNEIELENTVGVSKGVVDALDMSPKDLE
SSLIRRGSTRKSIKGPQGQDRKLSTKEGLDENVPPVSFWRILKLNITEWPYFVVGIFCAI
INGGLQPAFSIIFSRIIGVFTKVTDPETKRQDSNIFSLLFLILGIISFITFFLQGFTFGK
AGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQN
IANLGTGIVISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGAGKIATE
AIENFRTVVSLTREEKFESMYDQSLQVPYSNSLRKAHIFGITFSITQAMMYFSYAACFRF
GAYLVQHGHMDFQDVLLVFSAIVFGAMAVGQVSSFAPDYAKAKVSASHVIMIIEKTPQID
SYSTVGLKPNTVEGNLTFNEVMFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTV
VQLLERFYDPLAGKVLIDGREIKKLNVQWLRAHMGIVSQEPILFDCSIAENIAYGDNSRV
VSQEEIVQAAKEANIHPFIETLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRRPRILLL
DEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVQEYGTHQQ
LLAQKGIYFSMVSVQAGAKRSSTVTM
NT seq 3861 nt   +upstreamnt  +downstreamnt
atggatcttgaagaaggccgaatcgaaagagcagggaagaagaacttcttgaaaagggat
aaaaaaagtaaaaatgataagaaagaaaagaagccagctgtcagtgtttttgccatgttt
cgctattcaaactggcttgatagattgtatatgttgctggggactacggctgccatcatc
catggagctggactgcccctcatgatgctggtttttggagaaatgacagatagcttcgca
agtataggaaatatgggaaatttaacttttccaaatatgatttatgcaaattgtgtgaat
tgcccagataacagcaccacactggaggagaaaatgacagtgtacgcctattattactgt
ggcatcggtgctggcgtgcttgttgctgcttacatccaggtttcgttctggtgcctggca
gctggaagacagatacacaaaatcagaaaacagttttttcatgctatcatgcggcaggag
ataggctggtttgatgtgcatgatgttggggagcttaacacccggctcacagatgacgtc
tccaaaattaatgaaggagttggtgacaaaattggaatgttctttcagtcaatagcaacg
ttcttcactggttttatagtaggatttacacgtggttggaagctgactctagtgattctg
gccatcagtcctgttcttggtctgtcagctgctatctgggcaaagatactgtcttcattt
actgataaagaactcttggcctatgcaaaagctggagcagtagctgaagaggtgttagcc
gccattagaactgtgattgcatttggaggacaaaagaaagaacttgaaaggtataacaaa
aatttggaagaagccaaaaggattggaataaagaaagctattacagccaacatttctatt
ggtgccgctttcctgttgatttatgcatcctatgccctggcattctggtatgggaccacc
ttggtcctctcaaatgaatatactattggacaagtactcactgttttcttttctgtgtta
attggggcttttagtgttggacaggcctctccaagcattgaagcatttgcaaacgcaaga
ggagcagcttacgaaatcttcaaaatcattgatagtaagccaagcattgacagctattca
aagaatggacacaaaccagataatatcaagggaaatctggaattcagaaacgttcacttc
agttacccatctcgaaatgaagttaagatcttgaaggggctcaacttgaaggtagagagc
gggcagacggtggccctggtcgggaacagcggctgtgggaaaagcacgacggtccagctg
atgcagaggctctatgaccccacggagggcgtggtcagtattgatggacaggatatcagg
acgatcaacgtaaggtatctgcgggaaattatcggcgtggtgagccaggagcccgtgctc
tttgccaccacgatagctgagaacattcgctatggccgggaaaatgtcaccatggaagag
attgagaaagctgtgaaggaagccaacgcctatgactttatcatgaaactgcctaacaaa
tttgacaccctggttggagagagaggggcccagctgagtggtggacagaagcagagaatc
gccatcgctcgggccctggttcgtaacccgaagatcctcctgctggatgaggccacgtca
gcgctggacacggagagtgaagcggtggttcaggtggccctggataaggccagagaaggc
cggaccaccattgtgatagcccatcgtttgtccacagttcgcaatgctgatgtcattgct
ggttttgatgatggagtcattgtggagaaaggcagtcatgatgaactcatgaaggagaaa
ggcgtttacttcaaacttgtcacaatgcagacaaaaggcaatgaaatagaattagaaaat
acagttggtgtatccaaaggtgtagtcgatgctttggacatgtctccaaaagatttagaa
tccagtctaataagaagaggatcaactcgcaagagtatcaagggaccacaaggccaagac
agaaagcttagtacaaaagaaggcttggatgaaaatgtacctccagtttccttttggagg
attctgaagctgaatataactgaatggccttattttgtggttggcatattttgtgccatt
ataaatggaggtctgcaaccagcattttcaataatattttcaaggattataggggttttt
accaaagtcacagatcctgaaaccaaacgacaggacagtaacatattttcactcttgttt
ctaatccttggaattatttcttttatcacatttttccttcagggcttcacgtttggcaaa
gccggagagatcctcaccaagcggctgcggtacatggttttcaggtccatgctgagacag
gacgtgagctggttcgatgaccctaaaaacaccacgggagcattgaccaccaggcttgcc
aatgatgctgctcaagttaaaggggctattggttccaggcttgctgtcattacccaaaat
atagcaaatcttgggacaggcattgttatatcattcatctatggctggcaactaacactt
ttactcttggcgattgtacccatcattgcaatagcaggagttgttgaaatgaaaatgtta
tctggacaagcactgaaagataagaaagagctagaaggtgccgggaagattgccactgaa
gcaatagaaaacttccgaactgttgtttctttgactcgggaggagaagtttgaatctatg
tatgaccagagtttgcaggtaccatacagtaactctttgaggaaggcacacatctttgga
atcactttttccatcacccaggcaatgatgtatttttcttacgctgcctgtttccggttt
ggtgcctacttggtacaacatggccacatggactttcaggatgttctcttagtcttctca
gctattgtctttggtgccatggcagtgggacaggttagttcatttgctcctgactacgcc
aaagccaaagtgtcggcatcccatgtcatcatgatcattgaaaagacccctcagattgac
agctacagcaccgtgggcttaaagccgaatacagtggaaggaaatctgacatttaatgaa
gtcatgttcaactaccccactcgaccagacatcccagtgcttcaggggctgagcctggag
gtgaagaagggccagaccctggccttggtgggcagcagcggctgtgggaagagcacggtg
gtccagctcctggagcggttctacgaccccttggctggaaaagtgctaattgacggcagg
gagattaaaaaactgaacgtccagtggctccgagcacacatgggcatcgtgtcccaggag
cccatcctgtttgactgcagcattgctgagaacatcgcctatggggacaacagccgggtc
gtgtcccaggaggagatcgtgcaggcggccaaggaggccaacatccaccccttcatcgag
acactgcctgataaatataacaccagagtgggagacaaaggaacgcagctctctggcggc
cagaaacagcgcattgcaatagctcgtgcccttgtcagacggcctcgtattttgcttctg
gatgaagctacatcggctctggatacagaaagtgaaaaggttgtccaagaagccctggac
aaagccagagaaggccgcacctgcatcgtgatcgctcaccgcctgtccaccatccagaac
gcagacttgatcgtggtgattcagaacggcaaagtccaggagtatggcacacaccagcaa
ctgctggcacagaaaggcatctatttctccatggtcagcgtccaggctggagcaaagcgc
tcatcaactgtgaccatgtga

DBGET integrated database retrieval system