KEGG   Sus scrofa (pig): 100522792
Entry
100522792         CDS       T01009                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04062  Chemokine signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04070  Phosphatidylinositol signaling system
ssc04071  Sphingolipid signaling pathway
ssc04150  mTOR signaling pathway
ssc04270  Vascular smooth muscle contraction
ssc04310  Wnt signaling pathway
ssc04370  VEGF signaling pathway
ssc04510  Focal adhesion
ssc04540  Gap junction
ssc04650  Natural killer cell mediated cytotoxicity
ssc04662  B cell receptor signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04670  Leukocyte transendothelial migration
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04727  GABAergic synapse
ssc04728  Dopaminergic synapse
ssc04730  Long-term depression
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04916  Melanogenesis
ssc04918  Thyroid hormone synthesis
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04925  Aldosterone synthesis and secretion
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04929  GnRH secretion
ssc04931  Insulin resistance
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc04960  Aldosterone-regulated sodium reabsorption
ssc04961  Endocrine and other factor-regulated calcium reabsorption
ssc04970  Salivary secretion
ssc04971  Gastric acid secretion
ssc04972  Pancreatic secretion
ssc04973  Carbohydrate digestion and absorption
ssc05017  Spinocerebellar ataxia
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05031  Amphetamine addiction
ssc05032  Morphine addiction
ssc05140  Leishmaniasis
ssc05143  African trypanosomiasis
ssc05146  Amoebiasis
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05214  Glioma
ssc05223  Non-small cell lung cancer
ssc05225  Hepatocellular carcinoma
ssc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100522792 (PRKCB)
   04012 ErbB signaling pathway
    100522792 (PRKCB)
   04014 Ras signaling pathway
    100522792 (PRKCB)
   04015 Rap1 signaling pathway
    100522792 (PRKCB)
   04310 Wnt signaling pathway
    100522792 (PRKCB)
   04370 VEGF signaling pathway
    100522792 (PRKCB)
   04064 NF-kappa B signaling pathway
    100522792 (PRKCB)
   04066 HIF-1 signaling pathway
    100522792 (PRKCB)
   04020 Calcium signaling pathway
    100522792 (PRKCB)
   04070 Phosphatidylinositol signaling system
    100522792 (PRKCB)
   04071 Sphingolipid signaling pathway
    100522792 (PRKCB)
   04150 mTOR signaling pathway
    100522792 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100522792 (PRKCB)
   04540 Gap junction
    100522792 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100522792 (PRKCB)
   04662 B cell receptor signaling pathway
    100522792 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    100522792 (PRKCB)
   04670 Leukocyte transendothelial migration
    100522792 (PRKCB)
   04062 Chemokine signaling pathway
    100522792 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    100522792 (PRKCB)
   04929 GnRH secretion
    100522792 (PRKCB)
   04912 GnRH signaling pathway
    100522792 (PRKCB)
   04921 Oxytocin signaling pathway
    100522792 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    100522792 (PRKCB)
   04918 Thyroid hormone synthesis
    100522792 (PRKCB)
   04919 Thyroid hormone signaling pathway
    100522792 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    100522792 (PRKCB)
   04916 Melanogenesis
    100522792 (PRKCB)
   04925 Aldosterone synthesis and secretion
    100522792 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100522792 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    100522792 (PRKCB)
   04971 Gastric acid secretion
    100522792 (PRKCB)
   04972 Pancreatic secretion
    100522792 (PRKCB)
   04973 Carbohydrate digestion and absorption
    100522792 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100522792 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100522792 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100522792 (PRKCB)
   04727 GABAergic synapse
    100522792 (PRKCB)
   04725 Cholinergic synapse
    100522792 (PRKCB)
   04728 Dopaminergic synapse
    100522792 (PRKCB)
   04726 Serotonergic synapse
    100522792 (PRKCB)
   04720 Long-term potentiation
    100522792 (PRKCB)
   04730 Long-term depression
    100522792 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    100522792 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100522792 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100522792 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100522792 (PRKCB)
   05206 MicroRNAs in cancer
    100522792 (PRKCB)
   05205 Proteoglycans in cancer
    100522792 (PRKCB)
   05231 Choline metabolism in cancer
    100522792 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100522792 (PRKCB)
   05214 Glioma
    100522792 (PRKCB)
   05223 Non-small cell lung cancer
    100522792 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100522792 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    100522792 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100522792 (PRKCB)
   05032 Morphine addiction
    100522792 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100522792 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100522792 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100522792 (PRKCB)
   05161 Hepatitis B
    100522792 (PRKCB)
   05171 Coronavirus disease - COVID-19
    100522792 (PRKCB)
   05164 Influenza A
    100522792 (PRKCB)
   05163 Human cytomegalovirus infection
    100522792 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100522792 (PRKCB)
   05140 Leishmaniasis
    100522792 (PRKCB)
   05143 African trypanosomiasis
    100522792 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100522792 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100522792 (PRKCB)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100522792 (PRKCB)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100522792 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 100522792
NCBI-ProteinID: XP_020942118
LinkDB
Position
3
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGGEGNEE
LRQKFERAKIGQGTKTPEEKTTNTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagtgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggattccagtgccaagtctgctgttttgttgtgcacaagcggtgccatgaa
tttgtcaccttctcctgcccaggcgctgacaagggcccagcctctgatgacccccggagc
aaacacaagttcaagatccacacgtactccagccccacgttttgtgaccactgtgggtcc
ctgctgtatggactcatccaccaggggatgaagtgtgacacctgcatgatgaacgtccac
aagcgctgcgtgatgaacgtgcccagcctgtgtggcacagaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgagagggaggttctcatcgtggtcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcttgtcagacccttacgtgaaactgaaactg
attcctgatcccaagagcgagagcaagcagaagaccaaaaccatcaagtgctccctcaac
cccgagtggaacgagacatttagattccagctgaaagagtcagacaaagacagaagactg
tctgtagagatttgggattgggatttgaccagcaggaatgacttcatgggatctttgtct
tttgggatttccgaactgcagaaagccggtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaacgtacctgtgccaccagaaggaggggagggcaatgaggaa
ctgcggcagaaatttgagagggccaagatcggtcaggggaccaagactcccgaagagaag
acgaccaacaccatatccaagttcgataacaacgggaacagggaccggatgaaactgact
gattttaacttcttgatggtgttggggaaaggcagctttggcaaggtcatgctttccgag
cggaagggcacagatgagctgtacgcggtgaagatcctgaaaaaggatgtggtgattcaa
gacgatgatgtggaatgcacgatggtggagaagcgggtgctggccctgcccgggaagccg
cccttcctgacccagctgcattcctgcttccagaccatggaccgcctgtactttgtgatg
gagtatgtgaatggtggcgacctcatgtaccacattcagcaagtgggccgcttcaaagag
cctcacgctgtattttacgctgcagaaattgccatcggtctgttcttcttgcagagcaag
ggtatcatttaccgtgacctgaaacttgacaatgtgatgctggattccgagggccacatc
aagatcgctgattttggcatgtgtaaggaaaacatctgggatggggtgacgaccaagacc
ttctgtggcaccccagactacatcgcccctgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggcgaggatgaggatgaacttttccagtccatcatggaacacaacgtggcatat
ccaaagtccatgtccaaggaagccgtggccatctgcaaagggttgatgaccaaacacccg
ggcaaacgactgggttgcggacctgaaggtgaacgtgacatcaaagagcatgcgtttttc
cggtatatcgactgggagaaactcgaacgcaaagagattcagcccccatataagccgaaa
gcctgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccatccaccagtccta
acacctcctgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

DBGET integrated database retrieval system