KEGG   Sus scrofa (pig): 100523725
Entry
100523725         CDS       T01009                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100523725 (AXIN1)
   04390 Hippo signaling pathway
    100523725 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100523725 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100523725 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100523725 (AXIN1)
   05225 Hepatocellular carcinoma
    100523725 (AXIN1)
   05226 Gastric cancer
    100523725 (AXIN1)
   05217 Basal cell carcinoma
    100523725 (AXIN1)
   05213 Endometrial cancer
    100523725 (AXIN1)
   05224 Breast cancer
    100523725 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100523725 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100523725 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100523725 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100523725 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100523725 (AXIN1)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100523725 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Sec16
Other DBs
NCBI-GeneID: 100523725
NCBI-ProteinID: XP_020942585
Ensembl: ENSSSCG00000023204
LinkDB
Position
3
AA seq 880 aa
MNTQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPVSHSFCSGKGAGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLRQEHCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLARAIYRRYILDSGGVVSRQTKPATKSFIKDCIAKQQIDPA
MFDQAQTEVQSSMEANTYPAFLKSDIYAECTRAGAESPKACGEPGSAAGTGKGVPGYLPT
LNEDEEWTCDRGADEEAAGDPAPPGRLTQTLLLLETAAPRACSSRRYSEGREFRSHGKSS
GKMTLFQGGTESKRFSRSSRRGSAVNEPDWHPRGRGFKPHSVGHGSWREPVHSYYVNSGY
ALAPATSANDSEQQSLSSDADSLSLTDSSVDGIPPYRARKQHRREMQESLQVNGRGPLPH
IPRTYRMPKEVRVEPQKFAAELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEGGDVSSA
PPGASHKLPAAPAWHHFPARYADVGCVGLRDAHEENPESILDEHVQRVMRTPGCQSPGPG
HRSPENSHMPKIGVLGAAVPGHGKHAPKLGVKLDAAGLHLHRHSHHHGHHGAARPKEPAE
AEASRRVQSSFAWGPELHGHAAKPRSHLESLGTPLNTGDSLAYSGKAGMTSKRSAKKAES
GRSASAEAPGPSEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGAKKQQAHESSRPLSIE
RPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRASKVPS
KQRTKSQRKAGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGNYRY
YFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgaatacccaggagcagggcttccccttggacctcggcgcaagtttcaccgaagatgcc
ccccggcccccagtgcctggtgaggagggggagctggtgtccacagaccccaggcccgtc
agccacagcttctgctctgggaaaggtgccgggattaaaggggagacttcgacagccacg
ccgaggcgctcggacctggacctggggtacgagcccgagggcagcgcttcgcccaccccg
ccgtacttgaagtgggccgagtcgctgcactccctgctcgacgatcaggacgggataaac
ctgtttcggactttcctgaggcaggagcactgcgctgacctgctggacttctggttcgcc
tgcagcggcttcaggaagctggagccctgcgactcgaacgaggagaagaggctgaagctg
gcccgagcaatttaccgcaggtacatcctcgacagcggtggcgtcgtgtccaggcagacc
aagccggccaccaagagcttcatcaaggactgcatcgccaagcagcagatcgaccctgcc
atgttcgaccaggcgcagaccgaggtgcagtcgagcatggaggccaacacctaccccgcc
ttcctcaagtccgacatctacgctgagtgcacgcgcgcgggcgccgagagccccaaggcc
tgtggcgagccgggctccgcggcaggcacgggcaagggggtccccggatacctgcccacg
ctgaacgaggacgaggagtggacgtgcgaccgaggcgcggacgaggaggccgccggagac
cccgcaccgcccggcaggctcacgcagacgctgctgctgctggaaaccgccgccccgcgg
gcctgctcgagtagacggtacagcgaaggcagagagttcaggagccacggaaagagtagt
ggcaagatgactttattccagggagggacggaaagtaaaaggttctccaggagctcccgc
cgcggctcagcggttaacgaacccgactggcatccacgaggacgtgggttcaagcctcac
tcagtggggcatggatcctggcgggagcccgtccactcctactatgtcaactcgggctac
gctctcgcccccgccaccagcgccaacgacagtgagcagcagagcctgtccagcgatgct
gacagcctatccctcaccgacagcagcgtggacggaatcccgccctacagggcccgcaag
cagcaccgccgggagatgcaggagagcctccaggtcaacgggcggggccctctacctcac
attcctcgcacctaccgaatgccaaaggaagtccgcgtggagccccagaagttcgccgca
gagctcatccaccgcctggaggccgtccagcggacgcgggaggcggaggagaagctggag
gagcggctgaagcgcgtgcggatggaggaggaaggcgaaggtggtgatgtgtcctctgcc
cccccaggggccagtcacaagctgcctgcggccccggcctggcaccacttcccagcgcgc
tacgcggacgtgggctgcgtggggctgcgggacgcgcacgaggagaaccccgagagcatc
ctggacgagcacgtgcagcgggtcatgcggacaccgggctgccagtcgccaggacccggc
caccgctccccggagaactcgcacatgcccaagatcggggtgctgggggccgcggtgccc
ggacacggaaagcacgcgcccaagttgggggtgaagctcgacgcagctggcctgcacctc
cacagacacagccaccaccatggccaccatggtgccgccaggcccaaggagccggccgag
gccgaggcctcccgccgggtccagagcagcttcgcatggggcccggagctgcacggccac
gcggccaagccccgcagccacttggagagcctggggacccctctcaacaccggtgacagc
ctggcctacagcggcaaggcaggcatgacctccaaaagaagcgccaagaaggccgagtca
gggaggagtgccagcgcagaggcaccgggcccctccgaggatgcggagaagaaccagaag
atcatgcagtggatcatcgagggcgagaaggagatcagcaggcaccggaaggctgggcat
gggtcgtctggggcaaagaagcagcaggcccatgagagctccaggcccctgtccatcgag
cgtcctggggccgtgcacccttgggtcagcgcccagctccgcaactccgtccagccctcg
catctcttcattcaagaccccacgatgccgcccaacccggcccccaaccccctgacgcag
ctggaggaggcccgccggcgtctggaggaggaggagaagcgagccagcaaggtgccctcc
aagcagaggacgaaatcgcagaggaaggcaggcggagggagtgcccagccgtgcgatagc
atcgttgtggcctattacttctgtggggagcccatcccctaccggaccctggtgaggggc
cgcgcggtcacgctgggccagttcaaggagctgctgaccaagaaaggcaactacagatac
tacttcaagaaagtgagcgacgagttcgactgcggcgtggtgtttgaggaggtgcgcgag
gacgaggccgtcctgcccgtgtttgaggagaagatcattggcaaggtggagaaggtggac
tga

KEGG   Sus scrofa (pig): 100739604
Entry
100739604         CDS       T01009                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100739604 (AXIN2)
   04390 Hippo signaling pathway
    100739604 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100739604 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100739604 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100739604 (AXIN2)
   05225 Hepatocellular carcinoma
    100739604 (AXIN2)
   05226 Gastric cancer
    100739604 (AXIN2)
   05217 Basal cell carcinoma
    100739604 (AXIN2)
   05213 Endometrial cancer
    100739604 (AXIN2)
   05224 Breast cancer
    100739604 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100739604 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100739604 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100739604 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100739604 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100739604 (AXIN2)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100739604 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind SdrD_B
Other DBs
NCBI-GeneID: 100739604
NCBI-ProteinID: XP_020922392
LinkDB
Position
12
AA seq 843 aa
MSSAVLVPRLPDPSSSFHEDAPRPPVPGEEGETPPCQPGLGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKETKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEDNAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKLVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATANVRSTETVENGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDAMTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELETRHSLEERLQQIREDEEKEGTELATLSSREVGPA
QHPLSLLPSGTYEEDPQTILDDHLSRVLKTPGCQSPGMGRYSPRARSPDHHHHHHHQPYH
PLLPPGGKLPAAAAASPAGCPLLGAKGFVTKQTTKHVHHHYIHHHAIPKTKEEIEAEATQ
RVRCFCPGGAEYYCYSKCKSHPKSPEPVAPEQFGGSTPPRRNAKGTEPGPALPAREGGAP
GGAGALQLPGEEGDRSQDVWQWVLESERPSKPKPHSAQSTKRAYPLESARPSPAERAGRH
HLWGGSNGHPRTAPRAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATGQTGATPFSNPSLASEDHKEPKKLAGVHTLQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKTASDEFACGAVFEEIWDDEMVLPMYEGRILGKVE
RID
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgagcagcgctgtgctggtgcctcgcctcccagaccccagcagcagtttccacgaggat
gcccctcggccccccgtgcctggggaagaaggggagaccccaccatgccagcctgggctg
ggaaagggccaggtcaccaaacccatgcctgtctcctccaacaccaggcggaacgaggat
gggttgggggagcccgaggggcgggcatctccggattcccctctgaccaggtggacaaag
tcactgcactccttgttgggtgaccaagacggggcttatctcttccggactttcctggag
agggagaaatgcgtggataccttggacttctggtttgcctgcaatggattcaggcagatg
aacctgaaagagaccaaaactttacgagtagccaaagcaatctacaaaaggtacatcgag
aacaacagcgttgtctccaagcagctgaaacctgccaccaagacgtatataagagatggc
atcaagaagcagcagattgattccatcatgtttgaccaggcgcagactgagatccagtcg
gtgatggaggacaatgcctaccagatgtttctgacttctgatatatacctcgaatacgtg
aggagtgggggagaaaacacagcttacatgagtaacgggggcctggggagcctcaagctc
gtgtgtggctacctccccaccttaaatgaagaagaggagtggacttgtgccgacttcaag
tgcaaactctcacccactgtggttggcttgtccagcaaaactctgagggctactgcgaat
gtgcggtccacggaaactgttgaaaatggatacaggtccttcaagaggagcgaccccgtg
aatccataccacgtgggttctggctatgtctttgcgccggccaccagcgccaatgacagc
gagatctccagtgacgcaatgacggatgactccatgtccatgacggacagcagcgtagat
ggaatccctccttaccgcgtggggagtaagaaacagctccagagagaaatgcatcgcagc
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggagcccgccaccttcgcggcggagctgatctccaggctggagaag
ctgaagctggaattggagacccgccacagcctggaggagcgcctgcagcagatccgagag
gacgaagagaaggagggcaccgagctggcgacgctgagctcccgggaggtggggcccgcc
cagcaccccctctccctcctgccctcgggcacctatgaggaggacccgcagaccatcctg
gacgaccacctgtccagggtcctcaagacccccggctgccagtcccccggcatgggccgc
tacagcccacgtgcccgctcccccgaccatcaccaccaccaccaccaccagccgtaccac
ccgctcctcccacccgggggcaagctgcccgccgccgccgccgcctcccctgctggttgt
cccctccttggggccaagggcttcgtgaccaagcagacgacgaagcacgtccaccaccac
tacatccaccaccacgccatccccaagaccaaggaggagatcgaggccgaggccacccag
cgggtgcgctgcttctgccccgggggcgccgagtattactgctactccaagtgcaagagc
caccccaagtctccggagcccgtggcgcctgagcagtttggaggcagtaccccacccaga
cgaaatgcgaaaggcacggagccgggcccggccctgcccgccagggaaggaggggccccc
ggcggagcgggggcgctgcagcttcccggggaggaaggagacaggtcgcaggatgtctgg
cagtgggtgctggagagtgagcggccgagcaagcccaagccccatagtgcccaaagcacg
aaacgggcctaccccttagagtccgcccgcccgtccccagctgagcgagccggccgccac
cacctgtgggggggcagcaacgggcacccccgtaccgccccccgtgcccacccgttcacc
caggacccagcgatgcctcccctgaccccacccaacaccctggcacagctggaggaggcc
tgccgcaggctggctgaggtgtcgaagccccccaagcagcggtgctgcgtggccagtcag
cagagggacaggaaccactcggccactggtcagacaggagctacacctttctccaacccg
agcctggcttcagaagaccacaaagagccaaagaagctggcaggggtccacactctccag
gccagcgagctggttgtcacttactttttctgtggagaagaaattccgtacaggaggatg
ctgaaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaacagcgagcgacgagttcgcctgtggagcggttttcgaggag
atctgggacgatgagatggtgctgcctatgtatgaaggcaggattctgggcaaggtggag
agaatcgattga

DBGET integrated database retrieval system