KEGG   Sus scrofa (pig): 100524544
Entry
100524544         CDS       T01009                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04110  Cell cycle
ssc04360  Axon guidance
ssc04722  Neurotrophin signaling pathway
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05220  Chronic myeloid leukemia
ssc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100524544 (ABL1)
   04014 Ras signaling pathway
    100524544 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100524544 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100524544 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    100524544 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100524544 (ABL1)
   05206 MicroRNAs in cancer
    100524544 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100524544 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100524544 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100524544 (ABL1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100524544 (ABL1)
Protein kinases [BR:ssc01001]
 Non-receptor tyrosine kinases
  ABL family
   100524544 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 100524544
NCBI-ProteinID: XP_005660581
Ensembl: ENSSSCG00000005706
UniProt: A0A287BB27
LinkDB
Position
1
AA seq 1146 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGKKDSSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTRNGQGWVPSNYVTPVSSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKKGMRGAASP
LLQAPELPTKTRTARRAAEHKDAPDVPETPHSKGPGETDPPDHEPAVSPLLPRKERGPQD
GGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAVEDEGREA
SNGALALAPSDAAEPAKSPKPSGGAGVPNGAFRESGGAGFRSPHLWKKSSTLTSSRLAAS
EEESGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRASENRSDQVTRGTVTPPPRLAKKTEEEADEVFRDTAESSPGSSPPTLTPKLLRRQ
VPSSSSLPHKEDAGKCSALGAPAEPGPPTSRAGPGASGGPSKAPGEESRVRRHKPASESP
GRDKGKLSKLKPAPPPPPPASVGKVGKSSQSPSQEAAGEVGPSGKAKPAALAVDAVNSDA
AKPSQLGDGVKKPVLPSVPKPQSSTKPAGTPTSPASAPCTLPTASSALAGDQPSSTAFIP
LISTRVSLRKTRQPPERIASGAITKGMVLDGTEALCLAVSRNSEQMASHSAVLEAGKNLY
TFCVSYVDSIQQMRNKFAFREAINKLENSLRELQICPATAGSGPAATQDFSKLLSSVKEI
SDIVQR
NT seq 3441 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaagacggccaagtttgcctgccctg
cactttatcaaaggcgcagggaagaaggactcctcgagacacgggggcccacactgcaat
gtttttgtggaacatgaagcccttcagagaccagtagcatctgacttcgagccccagggt
ctgagtgaagcagctcggtggaactctaaggaaaaccttctcgctggtcccagtgaaaat
gaccccaaccttttcgttgcactgtatgatttcgtggccagtggggataacactttgagc
ataactaaaggggaaaagctccgggtcctgggctacaaccacaatggggagtggtgcgaa
gcccagacgagaaacggccaaggctgggtccccagcaactatgtcacgccggtcagcagt
ctggagaagcactcctggtaccacgggcccgtgtcccgcaacgccgccgagtacctgctg
agcagcgggatcaacggcagcttcttggttcgggagagcgagagcagtcccgggcagagg
tccatctcgctgcgatacgaagggagagtgtaccactacaggatcaacactgcctccgat
ggcaagctctacgtctcctccgagagccgcttcaacacgctggccgagctggttcatcac
cactcaacggtggccgacgggctcatcaccactctccactaccccgcccccaagcgcaac
aagcccaccgtctacggcgtgtcccccaactacgacaagtgggagatggagcgaacagac
atcaccatgaagcacaagctgggaggcggccagtacggggaggtgtacgagggcgtgtgg
aagaaatacagcctgacggtggccgtgaagaccttgaaggaggataccatggaggtagaa
gagttcttgaaggaagctgcagtcatgaaggagatcaagcaccccaacttagtgcaattg
cttggggtctgcaccagggagcccccgttctatataatcacagagttcatgacctatggg
aacctgctggattacctgcgagagtgtaaccggcaggaggtgaacgctgtggtgctgctg
tacatggccactcagatctcgtcagccatggaatacctggagaagaagaacttcatccac
agagatcttgctgcccggaactgcctggtaggggagaaccacttggtgaaggtggctgat
ttcggcctgagccggttaatgacgggggatacctacacggcccacgctggggccaagttc
cccatcaagtggactgcgcctgaaagcctggcctacaacaagttctccatcaagtcggac
gtctgggcgtttggagtcttgctttgggaaattgccacctacggcatgtcaccttaccca
ggaattgacctgtcccaggtgtatgagctgctagagaaagactaccgcatggagcgcccg
gaaggctgcccggagaaggtctacgaactcatgcgagcatgttggcagtggaatccctct
gaccggccctcctttgcggaaatccaccaagcctttgaaacaatgttccaggaatccagc
atatcagatgaagtggaaaaggagctggggaagaaaggcatgcgaggggccgcgagccct
ctgctgcaggccccggaactgcccaccaagaccaggaccgccaggagagccgccgaacac
aaagacgccccagacgtgcccgagacgccccactccaagggcccgggagagacggatcct
ccggaccacgagccggccgtgtctccgctgctgcctcgaaaagagcgcggccctcaggac
ggcggcctcaacgaagacgagcgcctgctccccaaagacaagaagaccaacttgttcagc
gccttgatcaagaagaagaagaagaccgccccgacccctcccaaacgcagcagctccttc
cgggagatggacggccagcccgagcgcagaggggccgtcgaggacgagggccgggaagcc
agcaacggggcgctcgcgctcgcaccctcggatgcggccgagccagccaagtccccaaag
cccagcggcggggccggcgtgcccaacggagccttccgggagtccgggggcgccggcttc
cggtccccccacctgtggaagaagtccagcaccctgaccagcagccggttagcagccagc
gaggaggagagcggcggcagctccagcaagcgcttcctgaggtcctgctctgcctcctgc
gtgccccacggggccaaggacacagagtggcggtcggtcacgctgcctcgggacctgcag
tccacgggaagacagtttgactcgtccacatttggggggcacaaaagtgagaagccagct
ctgccgcggaagcgggccagtgagaacaggtccgaccaggtgaccagaggcaccgtcacc
ccgccaccccggctggcgaagaagaccgaggaagaagctgacgaggttttcagagacaca
gccgagtccagcccgggctccagccctcccaccctgactccgaaactcctccgtaggcag
gttccatcttcctccagccttccccacaaggaagacgccggaaagtgcagtgccttgggg
gcacctgctgagccggggccccccaccagcagggccgggccaggtgcctctggagggccc
agcaaggcccctggcgaggagtccagagtgaggaggcacaagcccgcctccgagtcccca
gggagggacaagggaaagctgtccaaactcaagcctgccccgccgcccccaccgcccgcc
tctgttgggaaggtggggaagtcctctcagagcccgagccaggaggcagccggggaggta
ggccccagtgggaaggcgaagcctgcggctctggctgtggatgccgtgaacagtgacgct
gccaaacccagccagctgggagacggtgtcaaaaagcctgtgctcccgtccgtgccaaag
ccacagtcgtccaccaagccagccgggaccccaaccagcccagcctctgctccctgcacg
ctgccgacagcatcctctgccctggcgggggaccagccgtcctccaccgccttcatccct
ctcatatcgacccgcgtgtctcttcggaaaacccgccagcctccggagcggattgccagc
ggcgccatcaccaagggcatggtactggacggcaccgaggccctgtgcctggccgtctcc
aggaactctgagcagatggccagccacagcgccgtgctcgaagccggcaagaacctctac
acgttctgcgtgagctacgtggactccatccagcagatgaggaacaagttcgcctttcgc
gaggccatcaacaaactggagaacagtcttcgcgagcttcagatctgcccggcgacagca
gggagtggcccagcggccacccaggacttcagcaagctcctcagctccgtgaaggagatc
agtgacatcgtgcagaggtag

KEGG   Sus scrofa (pig): 100627019
Entry
100627019         CDS       T01009                                 

Gene name
ABL2
Definition
(RefSeq) Abelson tyrosine-protein kinase 2 isoform X6
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100627019 (ABL2)
   04014 Ras signaling pathway
    100627019 (ABL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100627019 (ABL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100627019 (ABL2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100627019 (ABL2)
Protein kinases [BR:ssc01001]
 Non-receptor tyrosine kinases
  ABL family
   100627019 (ABL2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 100627019
NCBI-ProteinID: XP_003357599
Ensembl: ENSSSCG00000024674
UniProt: A0A287AQK4
LinkDB
Position
9
AA seq 1064 aa
MVLGTVLLPPNNYGRDQDTSLCCLYGGASEAALPNLTDHFASCVEDGFEGDKTGGSSPEA
LHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLR
VLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSF
LVRESESSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFSTLAELVHHHSTVADGL
VTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVA
VKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRE
CNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMT
GDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVY
DLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEE
LGRAASSSSVVPYLPRLPTLPSKTRTLKKQGENKENIEGAQDATENSASSSAPGFIRSAQ
APSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREM
ENQPHKKYELTGLPEQDRMAMTLPRNCQKSKLQLERTVSTSSQPEENGDRANDTLPKKPE
EGAAPTRERPKAKLLPRGATALPLKTPSGDPAITEKDSPGVGVAGVTAAPKSKERNGGAR
LGMAGVPEDGEQTGWSSPAKAAVVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKF
KLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLPHPSMCSDPTEEPTAPTAGQPMSET
QEGGKKAAPGAVPISGKAGRPAMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEK
ISADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFRE
AVSKLELSLQELQVSSAAAGVPGANPVLNNLLSCVQEISDVVQR
NT seq 3195 nt   +upstreamnt  +downstreamnt
atggtccttgggacagtactgcttccacctaataattatggcagagatcaggacacatcc
ctttgctgcctgtacggtggggcctcagaagctgctctgcccaacttgacagatcacttt
gccagctgtgtggaggatggatttgagggagacaagactggaggcagtagtccagaagcc
ttgcaccgcccctatggttgtgatgttgaaccccaagccctgaatgaagccatcaggtgg
agctctaaggagaacttgcttggagccactgagagtgaccccaatctctttgttgcactt
tatgattttgtagcaagtggtgataacacacttagtatcactaaaggagaaaagctacga
gtccttggttacaaccagaatggtgagtggagtgaagttcgctctaagaatggccaaggc
tgggtgccaagcaattacatcaccccagtgaacagcctggaaaaacattcctggtaccat
gggcctgtgtcccgcagcgcagcagagtacctactcagcagtctgatcaatggcagcttc
ctggtgcgagaaagtgagagcagccccgggcagctatcaatctcgctcaggtacgagggg
cgtgtatatcactacaggatcaataccaccacagatggcaaggtgtatgtaactgctgag
agccgctttagcaccttggccgagcttgttcaccatcactcaacagtggctgatgggctc
gtgacaacactacactacccagcacccaagtgtaataagcctaccgtgtatggtgtgtcc
cccatccatgacaaatgggaaatggaacgaacagatattaccatgaagcacaaacttggg
ggtggtcagtatggagaggtttacgttggcgtctggaagaaatacagccttactgttgct
gtgaaaacgctgaaggaggatactatggaggtggaggaattcctaaaagaagctgcagtg
atgaaagaaatcaagcatcctaatctggtacaactattaggtgtatgtactttggagcca
ccattttacattgtgactgagtacatgccttatgggaacctgcttgattatctccgagaa
tgcaaccgagaagaggtaactgcagttgtactgctttacatggccactcagatttcttct
gcaatggagtatttagaaaagaagaatttcatccatagagatcttgcagctcgtaactgc
ctcgtgggagaaaaccatgtggtaaaagtggctgactttggcttaagtagattgatgact
ggagacacctatactgctcatgctggagccaaatttcctattaaatggacagcaccagag
agtcttgcctacaataccttctcaattaaatctgatgtctgggcttttggggttctcttg
tgggaaattgctacatatggaatgtcaccatatccaggtattgacctgtctcaggtctat
gatctgctggaaaaaggatatcgaatggaacaacctgaaggatgtcctcctaaggtgtat
gaacttatgagagcatgctggaagtggagccctgctgacaggccctcttttgctgaaaca
catcaagcttttgaaaccatgtttcatgactccagcatttctgaagaggtagctgaggag
ctcgggagagcagcctcctcctcatctgttgttccatatctgcctcgattacctacactt
ccttccaagacccggacgctgaagaaacagggggagaacaaggagaatatcgaaggggca
caagatgccacagaaaattctgcttccagttcagcaccagggttcattagaagtgcacag
gcccccagtgggtccccggcactgcctcgaaagcaaagagacaagtcacccagcagcctc
ttggaagatgccaaagagacttgcttcaccagagataggaagggaggcttcttcagctcc
ttcatgaaaaagagaaatgctcccacaccccccaaacgcagcagctccttccgagaaatg
gagaatcagccccacaagaaatatgaactcacggggcttccagagcaggataggatggca
atgacccttcccaggaactgccagaagtccaaactccagctggaaaggacagtgtccacc
tcttctcagccagaagagaatggggacagggccaatgacacgcttccaaaaaaaccagag
gaaggtgctgctccaaccagggagagaccaaaagccaaacttttgcccagaggagccaca
gctcttcctctcaaaaccccctctggggatccagccatcacagagaaggactctcccggg
gtgggggtagctggagtgacagctgccccaaagagcaaggagagaaatggtggggcacgg
cttggcatggctggagtcccagaggatggcgaacagacaggctggtcttctccagccaag
gctgcagtggtccttccaaccactcacaaccacaaagtgccagtccttatctcacccact
ctaaagcacactccagctgatgtgcagctcattggcacagactctcaggggaataaattc
aagctcttatcggagcatcaggtcacttcctctggagacaaggaccgaccccgccgggta
aaaccaaagtgtgccccacccccaccaccagtgatgagactactgccgcatccgtccatg
tgctcggacccgacggaagagccgactgccccgactgcaggacagcccatgtcagaaaca
caggaaggaggaaaaaaggcagctccaggggcagtgcccatcagtggaaaagctgggagg
cctgcaatgcctccacctcaagtgcctctgcccacatcttccatctcgccagccaaaatg
gccaacggcacagcaggtactaaagtggctctgagaaaaaccaaacaggcagctgagaaa
atctcagctgacaagatcagcaaggaggccctgctggaatgtgctgacctactgtcgagt
gcaatcacggaacctgtgcccaacagccagctggtggacactggacaccagctgctcgac
tactgctcaggctatgtggactgcatcccccagactcgcaacaaatttgccttccgagag
gccgtgagcaaactggaactcagtctgcaggagctgcaggtgtcttctgcagctgctggt
gtgcccggggcaaaccctgtccttaacaacctactgtcgtgcgtacaggaaatcagtgat
gtggtgcagaggtag

DBGET integrated database retrieval system