KEGG   Sus scrofa (pig): 100525045
Entry
100525045         CDS       T01009                                 

Gene name
ERBB3
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04020  Calcium signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100525045 (ERBB3)
   04012 ErbB signaling pathway
    100525045 (ERBB3)
   04020 Calcium signaling pathway
    100525045 (ERBB3)
   04151 PI3K-Akt signaling pathway
    100525045 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100525045 (ERBB3)
   05205 Proteoglycans in cancer
    100525045 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100525045 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100525045 (ERBB3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100525045 (ERBB3)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100525045 (ERBB3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Other DBs
NCBI-GeneID: 100525045
NCBI-ProteinID: XP_020947458
LinkDB
Position
5
AA seq 1338 aa
MRANRALQVLGFLLSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RTCPPCHEACKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRLFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKICEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGLRSLKEISAGRIYISANRQLCYHHSLNWTRLLRGPSEE
RLDIKHNRPRRDCVAEGRVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEGECFSCHSECQPMEGTATCNGSGSDACAQCAHFRDGPHCVSSCPFGVLGAKGPI
YKYPDAQNECRPCHENCTQGCKGPELQDCLGQALPLMSKTHLAMALTMVVGLAVVFLILG
STFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARVFKETELRKLKMLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGVLGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIPPGAEPPALTNKELEEVELEPELDLDLELEAEED
NLAPTLGSALSLPLGTLNRPRASQSLVSPSSGYMPMNQGNLGEACQEPAVCRGSERCPRP
ASLHPVPRGRLTSESSEGHVTGSEAELQEKVSMCRSRSRSPRPRGDSAYHSQRHSLLTPV
TPQSPPGLEEEDVNGYVMPDAHLKGTSSREGTLSSVGLSSVLGTEEEEEDEEYEYMNRRR
RCSPARPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLNPVPTMPNASTTPDEDYEYMN
RRRGGGGPGGDYAAMEACPAAEQGYEEMRAFQGPGHHGPQVHYARLKTLRSLEATDSAFD
NPDYWHSRLFPKANAQRT
NT seq 4017 nt   +upstreamnt  +downstreamnt
atgagggcgaaccgggctctgcaggtgctgggcttcctcctcagcctggcccggggctcc
gaggtgggcaactctcaggcagtgtgccctgggactctgaacgggctgagtgtgaccggc
gatgctgagaaccagtaccagaccctgtacaagctctacgagaggtgtgaggtggtcatg
gggaacctggagatcgtgctcacgggacacaatgctgacctctcctttctgcagtggatc
cgagaagtgaccggctatgtcctcgtggccatgaacgagttctctacgctgccactgccc
aacctccgggtggtgcgagggacccaggtctacgatgggaagtttgccatctttgtcatg
ttgaactacaacaccaactccagccacgctctgcgccagctccgctttactcagctcacc
gagattctgtcaggaggtgtttacattgagaagaacgacaaactttgtcacatggacaca
atcgactggagggacattgtgcgggacagagacgcagagatagtggtgaaggacaatggc
aggacttgtcccccctgtcatgaggcgtgcaagggacgatgctggggtcctggaccagaa
gactgccagacattgaccaagacgatctgcgcccctcagtgtaatggtcactgctttggg
cccaaccccaaccagtgctgccatgacgagtgtgcagggggctgctcaggccctcaggac
acagactgctttgcctgccggctcttcaatgacagtggagcctgtgtacgccagtgtcca
cagcctcttgtctacaacaagttaactttccagctggaacccaatccccacaccaagtat
cagtatggaggagtttgtgtagccagctgcccccataactttgtggtggatcaaacatct
tgtgtcagggcctgtcctcccgacaagatggaagtagataaaaatggactcaagatatgt
gaaccttgtgggggcctgtgccccaaagcctgtgaggggacgggttctgggagccgcttc
cagactgtggactcgagcaacattgatggatttgtgaactgcaccaagatcttgggcaac
ctggactttcttatcactggcctcaatggagacccctggcacaagatccctgctctggac
ccagagaagctcaatgtcttccggacagtgcgcgagatcacgggttacctgaacatccag
tcctggcctcctcacatgcacaacttcagtgtcttttccaatctgacgaccattgggggc
agaagcctctataatcggggcttctccttgttgatcatgaagaacttgaatgtaacctct
ctgggactccgatccttgaaggaaattagtgctggacgcatctacataagtgccaatcgg
cagctctgctaccaccattctctgaactggaccaggctgcttcgggggccttcagaagag
agactggacatcaagcataatcggccccgcagagactgcgtggcagagggcagagtgtgt
gacccgttgtgctcctccgggggatgctggggcccgggccctggtcagtgcctatcctgc
cgaaactacagccgaggcggcgtctgtgtgacccactgcaactttctgaatggggagcct
cgtgagtttgcccatgagggtgaatgcttctcttgccactcggaatgccaacccatggag
ggcactgccacatgcaatggctcgggctctgatgcttgcgcccagtgtgcccattttcga
gatgggccccactgtgtgagcagctgcccctttggagtcctcggtgccaagggccccatc
tacaagtacccagatgctcagaacgaatgtcggccctgtcatgagaactgcacccagggg
tgtaagggaccagagctacaagactgtttaggccaagcactgccactgatgagcaaaacc
cacctggcaatggctttaacaatggtagtaggactggcagtggttttcctgatcctgggc
agcacttttctgtattggcgtgggcgccgaattcagaataagagggctatgaggcgctac
ttggaacggggtgagagcatagagcctctggatcccagtgagaaggctaacaaagtcttg
gccagagtcttcaaagaaacagagctgaggaagcttaaaatgctgggctcaggggtcttc
ggaactgtgcacaaaggagtgtggattcctgagggtgaatccatcaagattcccgtctgc
attaaagtcattgaggacaagagcggacggcagagttttcaagctgtgacggatcatatg
ctggccattggcagcctcgaccacgcccacattgtacggctgctgggactgtgcccaggg
tcatctctgcagcttgtcacgcagtacttgcctctgggctccctgctggatcatgtgaga
caacaccggggggtactggggccacagctgctgctcaactggggagtacaaattgccaag
ggaatgtactaccttgaggagcatggcatggtgcacaggaacctggctgcccgaaatgtg
ctactgaagtcccccagtcaggttcaggtggcagattttggggttgctgacttgctgccc
cctgatgataagcagctactgcacagtgaggccaagactccaattaagtggatggcccta
gagagtatccactttgggaaatacacacaccagagtgacgtctggagctatggagtgaca
gtttgggagctgatgacctttggggcagagccctatgcagggctgcgactggctgaagta
ccagacctgctggagaagggggaacggttggcacagccccagatctgtactattgatgtc
tacatggtcatggtcaagtgttggatgattgatgagaacatccgcccaacctttaaagaa
ctagccaatgagttcaccaggatggcccgggacccaccacggtacctggttataaagaga
gaaagtggacctgggattccccccggggcagagccccctgctctaacaaacaaggaactg
gaggaagtagagctggagccggaactagacctggatctggagttggaggcagaggaggac
aacctggcccccacactgggctctgccctcagtctgccacttggaacacttaatcggcca
cgtgcaagccagagccttgtaagcccatcatctggatatatgcctatgaaccagggaaat
cttggggaggcttgccaggagcctgcagtttgtaggggtagtgaacggtgcccccgtcca
gcctctctgcacccagtgccacggggacgcctgacatcagagtcatcggagggccacgtg
acaggctctgaagctgagctccaggagaaggtatcgatgtgtagaagccggagccggagc
cctcggccacgaggagacagtgcctaccattcccagcgccacagcctgctcactcctgtc
accccacagtccccaccagggttagaggaagaggatgtcaatggttatgtcatgccagac
gcacacctcaaaggtacctcctcccgggaaggcaccctttcttcagtcggtctcagttct
gtcctggggaccgaggaagaagaagaagatgaggagtatgaatacatgaaccggaggaga
aggtgcagtccagctcgtcccccaaggccaagttccctcgaggagctgggttatgagtac
atggatgtgggatcagacctcagtgcttccctgggcagcacacagagttgcccactcaac
cctgtgcccaccatgcccaatgccagcacaactccagatgaggactatgaatatatgaat
cggcgacgtggtggagggggtcctgggggggattatgcagccatggaggcctgcccagca
gctgagcaagggtatgaagaaatgagagctttccaggggcctggacaccatggccctcag
gtccattatgcccgcctcaaaactctacgtagtttagaagccactgactccgcctttgat
aacccggattactggcatagcaggcttttccccaaggctaatgcccagagaacataa

DBGET integrated database retrieval system