KEGG   Sus scrofa (pig): 100525059
Entry
100525059         CDS       T01009                                 

Gene name
HHIP
Definition
(RefSeq) hedgehog-interacting protein isoform X1
  KO
K06231  hedgehog interacting protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04024  cAMP signaling pathway
ssc04340  Hedgehog signaling pathway
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100525059 (HHIP)
   04024 cAMP signaling pathway
    100525059 (HHIP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100525059 (HHIP)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100525059 (HHIP)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 100525059
NCBI-ProteinID: XP_003129219
Ensembl: ENSSSCG00000009045
UniProt: A0A287BB49 A0A4X1VHN3
LinkDB
Position
8
AA seq 700 aa
MLKMLSFKLLLLAVALGFFEGDAKFGERSEGSGARRRRCLNGNPPKRLKRRDRRMMSQLE
LLSGGEMLCGGFYPRLSCCLRSDSPGLGRLDSKIFSVTNNTECGKLLEEIRCALCSPHSQ
SLFHSPEREALGRDPVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCF
PDFPRKQVRGPASNYLDQMEEYDKVEDISRKHKHNCFCIQEVVSGLRQPVSALHSGDGSH
RLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAMGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCQVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVSKQWQEKPLCLGNG
GSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVHP
AQTLTSECSRLCRNGYCTPTGKCCCSPGWEGNFCRIAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNLRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgctgaagatgctctcctttaagctgctgctgctggccgtggctctgggtttctttgaa
ggagatgctaagtttggggaaagaagcgaagggagcggagcgaggaggagaaggtgcctg
aatgggaaccccccgaagcgcctgaaaaggagggataggcggatgatgtcccagctggag
ctgctgagtgggggagagatgctctgcggtggcttctaccctcggctgtcctgctgcctg
cggagtgacagcccggggctgggacgcctggatagcaagatattctctgtgaccaacaac
acagaatgcgggaagttactggaggaaatcagatgtgcgctctgctctccacactcccag
agccttttccactcacctgagagagaagccttgggaagagacccagtgcttcccctgctc
tgcaaagactattgcaaagaattcttttatacttgccgaggccatattccaggtttcctt
caaactactgctgatgagttttgcttttattatgcaagaaaagatggtggcttgtgcttt
ccagattttccaagaaaacaagtcagaggaccagcatctaattacttggaccagatggaa
gaatacgacaaagtggaagacattagcagaaagcataagcacaactgcttctgtatccag
gaggttgtgagtgggctgcgccagcctgtcagcgccctgcatagtggggacggctcacac
cgtctcttcattctggaaaaagaaggttacgtgaagatacttacccctgaaggagaaatt
ttcaaggagccttatttggacattcacaaacttgttcaaagtggaataaagggaggagat
gaaaggggactgctaagccttgcattccatcccaattataagaaaaatggaaagctgtat
gtgtcttataccaccaaccaggaacggtgggccatggggcctcatgaccatattctcagg
gttgtggaatacacagtctccagaaaaaatccccatcaagttgatttgagaacagccaga
gtattcctagaagtcgcagaactccacagaaaacatctggggggacagctgctctttggt
cctgatggctttttgtacatcatcctcggtgacgggatgatcacactggatgatatggaa
gaaatggacgggttaagcgacttcacaggttcggtgctccggctggacgtggacactgac
atgtgtcaggtgccgtattccatacccaggagcaacccgcacttcaacagcaccaaccag
cccccggaggtgtttgcccatggcctgcatgatccaggcagatgtgctgtggatcgacac
cccactgatatcaacatcaatttaacaattctttgttcagactccaatggaaagaacaga
tcatcagccagaatcctacagataataaaggggaaagattatgaaagtgagccatcactt
ttagaattcaagcctttcagtaatggtcctttggttggaggatttgtttaccgaggctgc
cagtctgaaagactctatggaagctacgtgtttggagaccgtaatgggaatttcttaact
ctccagcaaagtcctgtgagcaagcaatggcaagaaaaaccactctgtctcggcaacggt
ggttcctgtagaggttacttttcaggtcacatattgggatttggagaagacgaattaggt
gaagtttacattctatcaagtagtaaaagtatgacccagactcacaatggaaaactctac
aaaatcgtagatcccaaaagacctctgatgcctgaggaatgtagggccacagtccaccct
gcccagacgctgacgtcggagtgctcccgcctctgtcggaatggctactgtacccccacg
ggcaaatgctgctgcagcccaggatgggaagggaacttctgtcgaatcgcaaaatgtgag
ccagcatgtcgccatggcggtgtctgtgttagacccaacaagtgcctctgtaagaaagga
tatcttggtcctcaatgtgaacaagtggatagaaacctccgcagagtgaccagggcaggt
attcttgatcagatcattgacatgacatcttatttgctggatctaacaagttacattgta
tag

DBGET integrated database retrieval system