KEGG   Sus scrofa (pig): 100525120
Entry
100525120         CDS       T01009                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X3
  KO
K05460  hepatocyte growth factor
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc05144  Malaria
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05211  Renal cell carcinoma
ssc05218  Melanoma
ssc05223  Non-small cell lung cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100525120 (HGF)
   04014 Ras signaling pathway
    100525120 (HGF)
   04015 Rap1 signaling pathway
    100525120 (HGF)
   04020 Calcium signaling pathway
    100525120 (HGF)
   04151 PI3K-Akt signaling pathway
    100525120 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100525120 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100525120 (HGF)
   05205 Proteoglycans in cancer
    100525120 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100525120 (HGF)
   05226 Gastric cancer
    100525120 (HGF)
   05218 Melanoma
    100525120 (HGF)
   05211 Renal cell carcinoma
    100525120 (HGF)
   05223 Non-small cell lung cancer
    100525120 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    100525120 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100525120 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    100525120 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100525120 (HGF)
Cytokines and growth factors [BR:ssc04052]
 Growth factors
  Growth factors (RTK binding)
   100525120 (HGF)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100525120 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316 CWC25
Other DBs
NCBI-GeneID: 100525120
NCBI-ProteinID: XP_003130270
Ensembl: ENSSSCG00000015403
UniProt: A0A4X1SJC0 A0A480SZ19
LinkDB
Position
9
AA seq 730 aa
MWVTKLLQVLLLQHVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLINEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECLTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDVPM
ETTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRN
KDLKDYEAWLGIHDVHGRGDEKRKQVLNVTQLVYGPEGSDLVLLKLARPAVLDDFVSTID
LPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEIC
AGAENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHK
IILTYKVSQS
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaacttctacaagtcctgctgctgcagcacgtcctcctacacctcctc
ctgcttcccatcgccatcccctatgcagaaggacagaagaaaagaagaaacacacttcat
gaattcaaaaagtcagcaaagaccactctaattaacgaagacccattactgaagataaaa
accaaaaaaatgaatactgcagatcaatgtgccaatagatgtattaggaataaaggactt
ccattcacatgcaaggcctttgtttttgataaagcaagaaaacgatgtctctggttccct
ttcaatagcatgtcaagtggagtgaaaaaagaatttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggaggtagctataagggaacggta
tctatcactaaaagtggcatcaaatgccagccctggaattccatgataccacatgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcttgacctgcaatggggaaagttatcga
ggtcccatggatcatacagaatcaggcaagatttgtcagcgttgggatcatcagacacca
caccggcacaaattcttgccagaaagatatcctgacaagggctttgatgataattattgc
cgcaatcctgatggcaagccgaggccatggtgctatactcttgaccctgacaccccctgg
gagtattgtgcaattaaaatgtgcgctcacagtactatgaatgacacagatgtccctatg
gaaacaactgaatgcattcaaggtcaaggagagggttaccggggaaccatcaataccatt
tggaatggaattccatgtcagcgttgggattcccagtatcctcaccagcatgacataact
cctgaaaatttcaagtgcaaggacctaagagaaaattattgccgaaatccagatggggct
gagtcaccatggtgtttcaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaaatgtgacgtgtcaagtggacaagattgttatcgtgggaatggcaaaaattacatg
ggcaatctatccaaaacacgatctggactaacatgctcgatgtgggacaagaacatggaa
gatttacaccggcatatcttctgggaaccagatgctagtaagctgaataagaattactgc
cggaatcccgatgatgatgcccatggtccttggtgttacacagggaatcctcttattcct
tgggattattgccctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcctgtaatatcttgtgccaaaacaaagcaactgagagttgtaaatggaattcca
acacggacaaatgtaggatggatggttagtttgaaatacagaaataaacatatctgtgga
ggatcattgataaaggaaagttggattcttaccgcaagacagtgtttcccttctcgaaac
aaagacttgaaagattacgaagcatggcttggaattcatgatgtccatggaagaggagat
gagaaacgaaaacaggttctaaatgttactcagctggtatatggtcctgaaggatcagat
ctggtattactgaagcttgctaggcctgctgttctggatgattttgtcagtacaattgat
ttacctaattatgggtgcacaattcctgaaaaaaccacctgcagtgtttatggctggggc
tacactggattgatcaactcagacggcctattaagagtagcacatctctatattatgggg
aatgagaaatgcagccaatatcatcaagggaaggtgactctgaatgaatctgaaatatgt
gctggggctgaaaatattgtatcaggaccatgcgagggagattatggtggcccacttgtt
tgtgaacaacataaaatgagaatggtacttggtgtcattgttcctggtcgtggatgtgcc
attccaaatcgtcctggtatttttgtccgagtggcatattatgcaaaatggatacacaaa
attatattaacatataaggtatcacagtcgtag

DBGET integrated database retrieval system