KEGG   Sus scrofa (pig): 100525170
Entry
100525170         CDS       T01009                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X2
  KO
K02353  segment polarity protein dishevelled
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04330  Notch signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100525170 (DVL1)
   04330 Notch signaling pathway
    100525170 (DVL1)
   04390 Hippo signaling pathway
    100525170 (DVL1)
   04150 mTOR signaling pathway
    100525170 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100525170 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100525170 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100525170 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100525170 (DVL1)
   05226 Gastric cancer
    100525170 (DVL1)
   05217 Basal cell carcinoma
    100525170 (DVL1)
   05224 Breast cancer
    100525170 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100525170 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    100525170 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100525170 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100525170 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100525170
NCBI-ProteinID: XP_003127548
Ensembl: ENSSSCG00000003342
UniProt: F1RJE5 A0A4X1WAB8
LinkDB
Position
6
AA seq 700 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEISDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDGHADLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESVVSHRRERARRRNREEAARTNGHPRGDRRRDLGLPPDSAST
VLSSELESSSFIDSDEDDNTSRLSSSTEQSTSSRLIRKHKRRRRKQRMRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPSPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMGAVVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHLEGFRERREARRYASSMLKRGFL
RHTVNKVTFSEQCYYVFGDLCSNLAALNLNSGSSGASDQDTLAPLPHPAAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSAGGSSRRALGREKESRSAG
AGGSGSESDHTAPSGAGGSGWRERPASQLSRGSSPRSQASAAAPGLPPLHPLTKAYSVVG
GPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctatcacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtggcgcccgagcgcgtcacgctggccgacttcaagaacgtgctcagcaaccgg
ccggtgcacgcctacaaattcttcttcaagtccatggaccaggacttcggggtggtgaag
gaggagatctctgacgataatgccaagctgccctgcttcaacggccgtgtggtctcctgg
ctggtcctggctgagggcgcacactcggatgcggggtctcagggcactgatggccacgcg
gacctgcccccacctcttgagcggacgggtggcatcggggactcccggcccccctccttc
cacccgaacgtggccagcagccgcgatgggatggacaacgagactggcacagagtccgtg
gtcagccaccggcgggagcgagctcgccgccggaaccgtgaggaggctgcccggaccaac
gggcacccgaggggggaccggcggcgggatctggggctgccccccgacagcgcgtccact
gtgctgagcagcgagctcgagtccagcagcttcatcgactcggacgaggacgacaacacc
agtcggctgagcagctccaccgagcagagcacctcgtcccggctcatccggaagcacaag
cggcgccggcggaagcagcgcatgcgccagacggaccgcgcctcctccttcagcagcatc
acggactccaccatgtcgctgaacatcatcaccgtcacgctcaacatggagaggcaccat
ttcctgggcatcagcatcgtgggccagagcaacgaccggggcgatggcggcatctacatc
ggctccatcatgaagggcggggctgtggccgccgacggccgcatcgagccgggcgacatg
ctgctgcaggtgaatgacgtcaacttcgagaacatgagcaacgacgacgccgtgcgggtg
ctgcgggagattgtgtcccagacggggcccatcagcctcacggtggccaagtgctgggac
ccaagccctcggagctacttcaccatcccgagggctgacccggttcggcccatcgacccg
gccgcctggctgtcccacacggcggcgctgaccggagccctgccccgctacggtacgagc
ccctgctccagcgccgtcacgcgcaccagctcctcctcactaaccagctctgtgcccggc
gctccgcagctggaggaggcgcccctgacggtgaagagtgacatgggtgctgtcgtccgg
gtcatgcagctgccggactcgggcctggagatccgcgaccgcatgtggctcaagatcacc
atcgccaatgccgtcatcggggcggacgtggtggactggctgtacacgcacctggagggc
ttccgcgagcggcgggaggcgcgcaggtacgccagcagcatgctgaagcgcggcttcctg
cggcacacggtcaacaaggtcaccttctccgagcagtgctactacgtcttcggggacctg
tgcagcaatctcgcagccctgaacctcaacagcggctccagtggagcctccgatcaggac
acgctggccccgttgccccacccggctgccccctggcccctgggccagggctacccctac
cagtacccggggcccccgccctgcttcccacccgcgtaccaggaccctggcttcagctac
ggcagcggcagcgctgggagccagcagagtgaaggaagcaaaagcagtgggtccacccga
agtgctggcgggagcagccgtcgggccctgggtcgagagaaggagagccggtcggctgga
gctgggggcagtggcagcgagtcggaccacacagcgccaagcggggccggtggcagtggc
tggcgggagcgtccagctagtcagctcagccgcggcagcagcccgcgcagccaggcctcg
gctgccgcccctgggctccccccgctgcaccccctgacaaaggcctactcggtggtgggc
gggccgcccggggggccgcctgtccgggagctggccgcagtccccccagagctgacgggc
agccgccagtccttccagaaggccatggggaacccctgtgagttctttgttgatatcatg
tga

KEGG   Sus scrofa (pig): 100621038
Entry
100621038         CDS       T01009                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04330  Notch signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100621038 (DVL3)
   04330 Notch signaling pathway
    100621038 (DVL3)
   04390 Hippo signaling pathway
    100621038 (DVL3)
   04150 mTOR signaling pathway
    100621038 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100621038 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100621038 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100621038 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100621038 (DVL3)
   05226 Gastric cancer
    100621038 (DVL3)
   05217 Basal cell carcinoma
    100621038 (DVL3)
   05224 Breast cancer
    100621038 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100621038 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    100621038 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100621038 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100621038 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100621038
NCBI-ProteinID: XP_020925603
Ensembl: ENSSSCG00000025374
LinkDB
Position
13
AA seq 775 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHTTRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRWGFGFMGTVGQVTRRNPEPSGCRGPWVGHGLCGGDLGPAV
PLTGQGQASLVGNDCGPHRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDS
TMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQ
VNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAAW
VSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMAS
PESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTV
NKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYP
PPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDQKAGDSKSGGS
GSESDHTTRSSLRGPRERAPSERSGPATSEHSHRSHHSLASSLRSHHTHPSYGPPGVPPL
YGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgggcgagacgaagatcatctaccatctggatgggcaggagacgccgtatctggtgaag
ctgcccctgcccgcggagcgcgtcaccttggcggactttaagggcgttctgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaggaggagatc
tcggatgacaatgccaagctgccctgcttcaatggccgggtggtgtcctggctggtgtca
gctgagggctcacacccagagccagctcccttctgtgctgacaacccatcggaactgcca
ccgcccatggagcgcacaggaggcattggggactcccggcccccatccttccaccctcat
gctggtgggggcagccaggagaacctggacaatgacacagagacagactccttggtgtct
gctcagcgagagcggccacgccggagagatggcccagagcacacaacccggctaaatgga
actgcaaagggggaacggcggcgagagccagggggttatgatagctcatccactctcatg
agcagcgagttggagaccaccagcttctttgattcagatgaggatgactccaccagcagg
tggggctttggtttcatgggtactgtggggcaggtgacccggaggaaccctgaaccctca
ggatgccggggcccctgggtgggacatgggctttgtggtggggacctgggccctgcggtg
cctcttacggggcagggccaggccagcctggtggggaacgactgtgggccccacaggttc
agcagctccacagagcagagcagcgcttcgcgcctgatgagaagacacaagcggcggcgg
cggaagcagaaggtttcgcggattgagcggtcctcctccttcagcagcatcacggactcc
accatgtcactcaacatcatcacggtcactctcaacatggaaaagtacaacttcttgggc
atctctattgtgggccaaagcaacgagcgtggtgatggaggcatctacattggctctatc
atgaaggggggagccgtggctgctgatggacgcatcgagccaggagatatgctattacag
gtaaacgagattaactttgagaacatgagtaatgacgacgctgtccgggtactgcgggag
attgtgcacaaaccagggcccatcaccttgactgtagccaagtgctgggacccaagtcca
cgtggttgcttcacactacccaggagcgagcccatccggcccattgaccccgcagcctgg
gtctcccacactgcagccatgaccggcaccttccccgcctacggcatgagcccctccctg
agcaccatcacctccaccagctcctccatcaccagctccatccctgacacagagcgccta
gacgacttccacctgtccatccacagtgacatggctgccatcgtaaaagccatggcctcc
cctgaatctgggctggaagtccgtgaccgcatgtggctcaagattaccatccccaacgct
ttcattggctcggatgtggtggactggctgtaccacaacgtggaaggctttactgaccgg
cgagaggcccgcaagtatgccagcaacctgctgaaagctggcttcatccgccacactgtc
aacaagatcaccttctccgagcagtgctactacatcttcggcgacctctgtggcaacatg
gccaacctctcccttcacgatcatgacggctccagcggtgcctctgaccaggacactctg
gcccctctgccgcacccaggggcggctccttggcccatggctttcccttaccagtatccg
ccgcccccacacccctacaatccgcacccaggcttcccagagctggggtacagctatggc
gggggcagcgccagcagtcagcacagtgaaggcagccggagcagtggctccaaccgcagc
ggcagcgaccggcggaaggagaaagaccagaaggccggggactcaaagtcgggtggcagc
ggcagcgagtcggaccacacgacccgcagcagcctgcgggggcctcgggaacgcgcgccc
agcgagcgctcgggccctgccaccagcgagcacagccaccgcagccaccactcgctggcc
agcagcctgcgcagccatcacacacatccgagctacggcccccccggcgtgccccctctc
tacggcccccccatgctgatgatgcccccaccgcctgcggccatggggcccccgggagcc
cctccgggccgcgacctggcctccgtgccccctgaactgaccgccagcagacagtccttc
cgcatggccatgggaaaccccagtgagttctttgtggatgtgatgtga

KEGG   Sus scrofa (pig): 100625452
Entry
100625452         CDS       T01009                                 

Gene name
DVL2
Definition
(RefSeq) LOW QUALITY PROTEIN: segment polarity protein dishevelled homolog DVL-2
  KO
K02353  segment polarity protein dishevelled
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04330  Notch signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100625452 (DVL2)
   04330 Notch signaling pathway
    100625452 (DVL2)
   04390 Hippo signaling pathway
    100625452 (DVL2)
   04150 mTOR signaling pathway
    100625452 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100625452 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100625452 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100625452 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100625452 (DVL2)
   05226 Gastric cancer
    100625452 (DVL2)
   05217 Basal cell carcinoma
    100625452 (DVL2)
   05224 Breast cancer
    100625452 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100625452 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100625452 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100625452 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100625452 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100625452
NCBI-ProteinID: XP_003354990
Ensembl: ENSSSCG00000025689
LinkDB
Position
12
AA seq 736 aa
MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPAHEPRTDLAPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPS
GPSRLERHLAGYESSSTLLTSELESTSLGDSDEDDTLSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEDRAPESKSGSGSESEPSTRGGSLRRGGESGGTGDGGPPPSRGSSGGAPNVRG
HPGLHPYGPPPGVALPYNPMMVVMVPXPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcggagcggggggcggtggtgtcggggagacgaaggtgatttaccacctg
gatgaagaagaaactccctatctggtgaagatccctgtccccgccgagcgcataaccctc
ggcgatttcaagagcgtcttgcagcggcccgcgggcgcaaagtacttttttaagtctatg
gatcaggatttcggggtggtgaaggaagagatttccgacgacaatgcccgccttccctgc
ttcaacggaagggtggtatcctggctggtgtcatcagataacccccagcctgagatggcc
cccccggcccatgaacctcggacagacctggcacctccacccccaccgttaccccctttg
cctccagagaggaccagtggtattggggactccaggcctccatccttccaccctaacgtg
tccagcagccgggagaatctggagcccgagacggaaacagagtcagttgtgtctctgagg
cgggagcggcctcgcaggcgagacagcagtgagcacggcgctgggggccacaggcccagc
ggcccctcgcggctggagcgccacctggccgggtacgagagctcctccaccctcctgacc
agcgagctggagagcaccagcctgggggactcggacgaggacgacaccttgagcaggttc
agcagctccacggagcagagcagcgcctcccgcctcctcaagcggcaccggcggcggcgg
aagcagcggcccccccgcctggagaggacctcgtccttcagcagcgtcaccgactccacc
atgtctctcaacatcatcaccgtcacgctcaacatggagaagtacaacttcctgggcatc
tccatcgtgggccaaagcaacgagcggggagacggtggcatctacatcggctccatcatg
aaggggggcgctgtggccgccgacgggcgcattgagcccggggacatgcttttgcaggtg
aacgacgtgaacttcgagaacatgagcaacgatgacgcggtgcgggtgctgagggacatc
gtgcacaagcccggccccatcgtgctgaccgtggccaagtgctgggacccctctccccag
gcctatttcactctgccacgaaatgagcccatccagccgatcgaccctgccgcctgggtc
tcacactctgctgcgctgaccggcaccttcccagcctatccgggctcctcgtccatgagc
accatcacgtctgggtcctctcttcctgacggctgtgagggccggggcctctccatccat
acggacatggcatctgtgaccaaggccatggcagctcccgagtctggactggaagttcga
gaccgcatgtggctcaagatcaccatccctaatgcctttctgggctcggacgtggtcgac
tggctctaccatcacgtggagggctttccggagcggcgcgaggcccggaagtacgccagc
gggctgctcaaggcgggcctcatccggcacacggtgaacaagatcaccttctccgagcag
tgctattacgtcttcggagacctcagcggcggctgtgagagttacctggtcaacctgtcg
ctgaacgacaacgatggctccagtggtgcctcggatcaggacaccttggctcctctgcct
ggggccaccccctggcccctgctgcccaccttctcctatcagtaccccgccccgcacccg
tacagtccccagcccccaccctaccacgagctctcgtcctacacctacggcggaggcagc
gccagcagtcagcacagcgaggggagccggagcagcgggtccacacgaagcgatgggggg
gcagggcgcacggggaggcccgaggatcgggcccctgagtccaaatccggcagcggcagt
gagtccgagccctccacccggggcggcagccttcggcggggcggggaatccggggggact
ggtgatgggggccctccgccttccaggggctcatcaggaggcgctcccaatgtccgaggc
cacccggggctgcacccctacggcccaccccctggcgtggccctcccgtataaccccatg
atggtggtcatggtgccgncccccccgccccccgtccccccagcagtgcagcctccaggg
gcccctccagtcagagacctgggctccgtgcccccagagctgacggccagccgccaaagc
ttccacatggccatgggcaaccccagtgagttctttgtggatgttatgtag

DBGET integrated database retrieval system