KEGG   Sus scrofa (pig): 100525205
Entry
100525205         CDS       T01009                                 

Gene name
FOSL1
Definition
(RefSeq) fos-related antigen 1
  KO
K04502  fos-like antigen 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04380  Osteoclast differentiation
ssc04657  IL-17 signaling pathway
ssc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100525205 (FOSL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100525205 (FOSL1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100525205 (FOSL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100525205 (FOSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100525205 (FOSL1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100525205 (FOSL1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 Macoilin Prefoldin_2 DUF4407 TMCO5 UPF0242
Other DBs
NCBI-GeneID: 100525205
NCBI-ProteinID: XP_003122567
Ensembl: ENSSSCG00000012967
UniProt: A0A287BK33
LinkDB
Position
2
AA seq 271 aa
MFRDFGEPGPSSGAGGAYGGPAQPPVTGQQKFHLVPSINAVSGSQELQWMVQPHFLGPSS
YPRPLAYPQYSPPQPRPGVIRALGPTPAVRRRHCEQISPEEEERRRVRRERNKLAAAKCR
NRRKELTDFLQSETDKLEDEKAGLQREIEELQKQKERLELVLEAHRPICKIPEGARESDT
SGTGGTSGTSSPPDPSRPMPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST
PEPCASAHRRSSSSSGDPSSDPLGSPTLLAL
NT seq 816 nt   +upstreamnt  +downstreamnt
atgttccgagacttcggggaaccgggaccgagctccggggccggaggtgcgtacggcggc
ccggcgcagcccccggtgacaggccagcagaagttccacctcgtgccaagcatcaacgct
gtgagtggcagccaggagctgcagtggatggtacagcctcacttcctgggacccagcagc
taccccaggcctctggcgtacccccagtacagtcccccacaaccccggccgggagtcatc
cgggctctggggccaactccggcagtgcgtcgccggcactgtgaacagatcagccccgag
gaggaggaacgccgtcgagtgaggcgcgagcggaacaagctagccgccgccaagtgcagg
aaccgaaggaaagaactgaccgacttcctgcagtcggagaccgacaaactggaggacgag
aaagccgggctgcagcgagagattgaggagctgcagaagcagaaggagcgcctggagctg
gtgctggaagcccaccggcccatctgcaaaatcccagaaggggccagggagagcgacacc
agcggcacaggcggtaccagtggcaccagcagcccgccagacccttcccgccctatgcct
tgtatctccctttcccctgggcctgtgcttgaaccggaagcattgcacactcccacgctc
atgaccacaccctccctgactcctttcacccccagtctggtcttcacctaccccagcacc
ccggagccctgtgcctcagcccatcgtaggagtagcagcagcagtggggacccctcttct
gacccccttggctccccaaccctcctggccttatga

DBGET integrated database retrieval system