KEGG   Sus scrofa (pig): 100525789
Entry
100525789         CDS       T01009                                 

Gene name
ERBB4
Definition
(RefSeq) LOW QUALITY PROTEIN: receptor tyrosine-protein kinase erbB-4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04020  Calcium signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc05014  Amyotrophic lateral sclerosis
ssc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100525789 (ERBB4)
   04012 ErbB signaling pathway
    100525789 (ERBB4)
   04020 Calcium signaling pathway
    100525789 (ERBB4)
   04151 PI3K-Akt signaling pathway
    100525789 (ERBB4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100525789 (ERBB4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100525789 (ERBB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100525789 (ERBB4)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100525789 (ERBB4)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100525789 (ERBB4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like DUF3951
Other DBs
NCBI-GeneID: 100525789
NCBI-ProteinID: XP_020931627
LinkDB
Position
15
AA seq 1308 aa
MKLATGLWGWMSLLVAAGTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYTDTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGRTCIESCNLYD
GEFREFENGSICVECDPQCEKMEDGILTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADEDRECHPCHPNCTQGCSGPTSHDCIYYLWTGHSTLPQHARTPLIAAGVIGG
LFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGMPVP
YRATTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVTPHVQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASSGPPKAED
EYVNEPXYLNTFANALGNAEYLKNNVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
NT seq 3927 nt   +upstreamnt  +downstreamnt
atgaagctggcgacaggactgtggggctggatgagccttctcgtggcggcggggaccgtc
cagcccagcgcttctcagtcagtgtgcgcaggaacagagaataagctgagctctctctct
gacctggagcagcagtaccgagccttgcgaaaatactatgagaactgtgaggtagtcatg
ggcaacctggagataaccagcattgagcacaaccgggacctctcctttcttcggtctata
cgagaagtcacaggctatgtgttggtggctcttaatcagtttcgctacctgcctctggag
aatttacgcattattcgtgggacaaaactttatgaagatcgatatgccttggcaatattc
ttaaactacaggaaagatggaaactttggacttcaagaacttggactgaagaacttaaca
gaaatcctaaatggcggagtctatgtagaccagaacaaatttctttgttacacagacacg
attcattggcaagatattgttcggaatccatggccttccaacctgacgctggtgtcaaca
aatggtagctcaggatgtggacgttgccataagtcctgtactggccgatgctggggaccc
acagaaaatcattgccaaactttaacaaggacagtttgtgcagaacaatgtgatggcaga
tgctacgggccctatgtcagtgactgctgtcatcgagagtgtgctggaggctgctcagga
cctaaggacaccgactgctttgcctgcatgaatttcaatgacagtggagcatgtgttact
cagtgtccacaaacttttgtctacaatccaaccacctttcagctggagcataacttcaat
gcaaaatacacctatggagcattttgcgtcaagaagtgcccacataacttcgtggttgat
tccagttcttgtgtgcgtgcctgccctagttccaagatggaagtggaagaaaatgggatt
aaaatgtgtaaaccttgcactgacatctgcccaaaagcttgtgatggcattggcacagga
tcattgatgtcagctcagactgtggattctagtaacattgacaaattcataaactgcacc
aaaatcaatgggaatttgatcttccttgtcactggtattcatggggatccttacaatgca
attgaagccatagacccagagaaactgaatgtctttcggacagtccgagagataacaggt
ttcttgaacatacaatcatggcccccaaacatgaccgacttcagtgttttttctaacctg
gtgactattggtggaagagtactctatagtggcctttccctgcttatcctcaagcaacag
ggcatcacttcactacaattccagtccctgaaggaaatcagtgcaggaaacatctatatc
acagacaacagcaacctgtgttattatcataccattaactggacaacactcttcagcacc
atcaaccaaagaatagtgattcgggacaacaggaaagctgaaaactgtactgctgaagga
atggtatgcaaccatctctgttcaaatgatgggtgttggggacctgggccagaccagtgc
ctgtcctgtcgtcgcttcagcaggggaaggacctgcatagagtcttgtaacctctatgat
ggtgaatttcgagagtttgagaatggctccatctgtgtggagtgtgacccccagtgcgag
aagatggaagatggcatcctcacgtgccatggaccgggacctgacaactgcacaaagtgc
tcccattttaaggatggcccgaactgtgtggaaaaatgtccagatggcttacaaggggca
aacagtttcattttcaaatatgctgatgaggatcgggagtgccacccatgccatccaaac
tgcacccaagggtgtagcggtccaactagtcatgactgcatttactacctttggacgggc
cattccacattaccacaacatgctaggactcccttaattgcagctggagtcattggtgga
ctcttcatcctagtcattgtgggtctaacatttgcagtttatgttagaagaaagagcatc
aaaaagaaaagagccttaagaaggttccttgaaacagagttggtagaacccttaactccc
agtggcacagctcccaatcaagctcaacttcgaattttgaaagaaactgaactcaagaga
gtaaaagtacttggctcaggtgcttttggaacagtttataaaggtatttgggtccctgaa
ggagaaacagtgaagattcctgtagctattaagattcttaatgaaacaactggtcccaaa
gccaatgtggaatttatggatgaagctctgatcatggcaagtatggaccatccacaccta
gtgcggttattaggtgtgtgtctgagcccaaccattcagctggttacacagctcatgccc
catggctgcctgttggattatgtccatgaacacaaagataacattggatcacaactgttg
cttaattggtgtgtccagatagcaaagggaatgatgtacctggaagaaagacggcttgtt
catcgggatttagcagcccgtaatgtcttagtgaaatctccaaaccatgtgaaaatcaca
gattttggactagccaggctcttggaaggagatgaaaaagagtataatgctgatggagga
aagatgccaattaaatggatggctctggagtgtatacactataggaaattcacccatcag
agtgacgtttggagctatggagtcactatatgggaactgatgaccttcggaggaaaaccc
tacgatggcattccaacgagagaaatccctgatttattagagaaaggagaacgtttgccc
cagcctcccatctgcactattgacgtttacatggtcatggtcaaatgttggatgattgat
gctgacagtagacctaaatttaaggaactggctgctgaattttcaagaatggctcgagat
cctcaaagatatctagttattcagggagatgaccgtatgaagctgcccagtccaaacgac
agcaagttctttcagaacctcttggatgaagaggatttagaagatatgatggatgctgag
gaatacctggtccctcaggctttcaacatcccacctcccatctatacttccagagcaagg
attgactcaaacaggagtgaaattggacacagccctcctcctgcctacacccccatgtca
ggaaaccagtttgtgtaccgagatgggggttttgctgcagaacaaggcatgcctgtgccc
tacagagccacaaccagcaccatcccagaagccccagttgctcagggggctacagctgag
atttttgatgactcctgctgtaatggcaccttacgcaagccagtgacaccccatgtccaa
gaagacagcagtacccagaggtacagcgccgaccccacagtgtttgccccagaacggagc
ccacgaggagagctggatgaagaaggttacatgacccctatgcgagacaaacccaaacaa
gaatacctgaaccctgtggaggagaacccttttgtttctcggaggaaaaatggagacctc
caagctttggataatcccgaataccacagtgcttccagtggtccacccaaggcagaagat
gaatatgtgaatgagccantgtacctcaacacctttgccaatgccttggggaatgctgag
tacctgaagaacaacgtactgtctgtgccagagaaggccaagaaagcattcgacaaccct
gactactggaaccacagtctgccacctcggagcacccttcagcacccagactacctgcag
gagtacagcacaaaatatttttataaacaaaatggacggatccggcctattgtggcagag
aatcctgaatacctctctgagttctcactgaagccaggcactgtgctgcctcccccaccc
tacagacaccggaatactgtggtgtaa

DBGET integrated database retrieval system