KEGG   Sus scrofa (pig): 100526132Help
Entry
100526132         CDS       T01009                                 

Gene name
GAA
Definition
(RefSeq) LOW QUALITY PROTEIN: lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00052  Galactose metabolism
ssc00500  Starch and sucrose metabolism
ssc01100  Metabolic pathways
ssc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100526132 (GAA)
   00500 Starch and sucrose metabolism
    100526132 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100526132 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100526132 (GAA)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100526132 (GAA)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100526132 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100526132
NCBI-ProteinID: XP_020922164
Ensembl: ENSSSCG00000017156 ENSSSCG00000023922
LinkDB All DBs
Position
12
AA seq 945 aa AA seqDB search
MRWPPCSRPLLGVCALISLALLGHVLLHDFLVXPRELRSFSQEPEEMYKARRPGASSPGP
QPGPGHRGSPSAVPTRCDLPPNSRFDCAPDKAITQEQCEARGCCYVPAGPGPLGAQMGQP
WCFFPPNYPSYRLENLTTTETGYTATLTRATPTFFPKDVMTLRLDVLLETESRLHFTIKD
PNNRRYEVPLETPRVRSRAPSTLYSVEFSDEPFGVVVRRKPSGRVLLNTTVAPLFFADQF
LQLSTSLPSQHITGLAEHLGSLMLSTNWTKATLWNRDIAPAPDLNLYGSHPFYLVLEDGG
SAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYLFLGPEPKSVVRQYLDVVGYPFMPP
YWALGFHLCRWGYSSTAITRQVVENMTTARFPLDVQWNDLDYMDARRDFTFNKDSFGDFP
AMVRELHQGGRRYVMIVDPAISSSGPPGTYRPYDEGLRRGXFVTNETGQPLIGKVWPGLT
AFPDFTNPEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPDSDLENPPYVP
GVVGGMLQAATICASSRQFLSTHYDLHNLYGLTEALASHRALVKVXGTRPFVISRSTFAG
HGRYAGHWTGDVWSNWEQLSYSVPEILLFNLLGVPLVGADICGFLGDTSEELCVRWTQLG
AFYPFMRNHNNLNSLPQEPYRFSDSAQRAMRKAFTLRYTLLPYLYTLFHGAHVRGETVAR
PLFLEFPEDPRTWTVDRQLLWGEALLVTPVLEAGQVQVTGYFPCGTWYDLQTVPVEPSGS
LPPPAPLPPAIHSKGQWVTLPAPLDTISLHLRAGCIIPMQGPGLTTTESRKQPMALAVAL
TTSGKAQGELFWDDGESLGVLDRGAYTQVVFLAQNNTIVNELVHLSSEGADLQLRRVTVL
GVATAPQNVLSNGVPVSNFTYSADTETLDIPVSLRMGEQFLISWS
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggccgccctgctcccgccccctgctgggggtctgtgccctcatctccttggcc
ctcctggggcacgtcctgctccacgacttcctggtgngtccccgagagctgcgcagcttc
tcccaagagcccgaggagatgtacaaagctcgccggcccggagccagcagcccggggccc
cagcccggcccagggcaccgtggcagtcccagcgctgtgcccacacggtgcgacctaccc
cccaacagccgcttcgactgcgccccagacaaggccatcacccaggagcagtgtgaggcc
cggggctgctgctacgtgcctgcagggccagggccactgggcgcccagatggggcagccc
tggtgcttcttccctcccaactaccccagttacaggctggagaacctgaccaccaccgag
acgggctacacggccaccctgacccgcgccaccccgaccttcttccccaaggacgtcatg
accttacggctggacgtgctgctggagactgagagccgtctccacttcacgatcaaagat
cccaacaataggcgctacgaggtgcccttggagaccccgcgtgtccgcagccgggcaccc
tccacactctacagcgtggagttctcagacgagccttttggggtggttgtgaggcggaag
ccgtctggacgggtgctgctgaacacgacggtggccccgctgttcttcgccgaccagttt
ctgcagctgtccacctccctgccgtcccagcacatcacgggcctcgccgagcacctcggg
tccctgatgctcagcaccaactggaccaaggccaccctctggaatcgggacatcgccccc
gcgcctgacttgaacctatacgggtcccaccctttctacctggtgctggaggatggcggg
tcggctcacggggtcttcctgctgaacagcaatgccatggacgtggtcctgcagcccagc
ccagccctcagctggaggtcgacaggcgggatcctggacgtgtacctcttcctgggcccg
gagcccaagagcgtggtgcggcagtacctggacgtcgtgggctacccgttcatgccgccg
tactgggccctgggcttccatctgtgccgctggggctactcctccaccgccatcacccgc
caggtcgtggagaacatgaccacggcccgcttccccctggacgtccagtggaacgacctg
gactacatggacgccaggcgggacttcactttcaacaaggacagcttcggggacttcccg
gccatggtgcgggagctccaccaaggcggccggcgctacgtgatgatcgtggatcctgcc
atcagcagctccggccccccagggacctaccgcccctatgacgagggtctgcggaggggg
ntcttcgtcaccaatgagacggggcagccgctgattgggaaggtgtggcctggactcacc
gctttccctgacttcaccaatcccgaggcccttgactggtggcaggacatggtggctgag
ttccacgcccaggtgccctttgatggcatgtggattgacatgaacgagccgtcgaatttc
gtgaggggctcagtggacggctgccctgacagcgacctggagaaccctccttacgtgcca
ggggttgtgggcgggatgctccaggcagccaccatctgcgcgtcaagccgccagttcctc
tccacgcactacgacctgcacaacctgtatggcctgactgaagccttggcctcccacagg
gcactggtgaaggttncggggacgcgtccctttgtgatctctcgctcgaccttcgcgggc
cacggccgatacgccggccactggacaggggatgtgtggagcaactgggagcagctttcc
tactctgtgccagaaatcctgctcttcaatctgctgggggtgcccctggtgggggctgac
atctgcggcttcctgggcgacacttcggaggagctttgcgtgcgctggacccagctgggg
gccttctaccctttcatgaggaaccacaacaacctgaacagcctgccgcaggagccgtac
cggttcagcgactctgcgcagcgagccatgagaaaggccttcaccctgcgctacacactg
ctgccctacctctacacgctgttccacggggcccacgtcaggggcgagactgtggccagg
cccctcttcctggagttccccgaggacccccgcacctggactgtggaccgacagctcctg
tggggggaggctctgcttgtcaccccggtgctcgaggctgggcaggtccaggtcactggc
tactttccgtgtggcacgtggtacgacctgcagacagtgccagtggaaccctctggcagc
cttccgcctcctgcacccctcccacctgccatccacagcaagggacagtgggtgacgctg
cccgccccactggacaccatcagcctccacctccgggccgggtgcatcatccccatgcag
ggccctggactcacgaccacagaatcccgtaagcagcccatggccctggctgtggccctg
accacgagtggaaaggcccaaggggagctgttctgggacgacggggagagcctgggagtg
ctggaccgtggggcctacacgcaggtcgtcttcctggcccaaaataacaccatcgtgaac
gagctggtgcacctgagcagtgagggggccgacctgcagctgaggagggtgacggtcctg
ggggtggccacagccccccaaaacgtcctctccaacggtgttcctgtctccaacttcacc
tacagcgccgacacagagaccctggacatccctgtctcgctgaggatgggagagcagttt
ctcatcagctggtcttaa

DBGET integrated database retrieval system