KEGG   Sus scrofa (pig): 100620852Help
Entry
100620852         CDS       T01009                                 

Gene name
PRAG1
Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein kinase SgK223
  KO
K17537  tyrosine-protein kinase SgK223 [EC:2.7.10.2]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100620852 (PRAG1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100620852 (PRAG1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: Other
  NKF3 family
   100620852 (PRAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 100620852
NCBI-ProteinID: XP_020933067
LinkDB All DBs
Position
17
AA seq 1414 aa AA seqDB search
MHQTIPLNPESPKMSACSDFVEHIWKPGSCKNCFCLRSDHQLEPGRPQPRASSLPPPPRL
PPRPENGRPEDDSLSSSPYSKPTIAVKPTMMSSEASDGWTEPGVSADVAQVIWRRAPGKL
PLPKQEDVPLVYLGSFRGVQKSAGSSAPADSQPCCPPACAMVGLHSIEPRGERNASFHPL
SFPDEKLGQEDKPTIPYQELTSTQESFRQKLAAFAGMTSGCHKGSGSYPSAQPLRESLPS
EDDSDQRCSPSGDSEGGEYCSILECCPGSPGVEDTSQAEGSRHRHGGRDCLPACWEQGVC
ARPTPEEKRALSFPRECCSQGPAENPPRLGPKKQSLTSEAASSSDGLSCGSVSSRASSPL
SPHVESDYCSLMKEPGSGKQQDPGCHRVASSRCLGLTVEPQPPAPSREAAQPEPIYAEST
KRKKAVSMPSRPQAKAEQAAAAXQGQVRTANTWAQKTAGRGQDKEGSDMAPQVAATITVM
AAHPEEDHRTIYLSSPDSSVGVQWPRGPPSQTPEAGEESPSAGQGLSSRESHHLGASENT
PKGRPAIPPKLSRSSPGGSPVSPSASPLSDLSEGNSGVPGPQRPSRGPADPTSSCQANSV
PTSDSVRGPPSGTTTSADQRRPRYQTGAWSRQCRIEEEEEVEQDLLSQSWGREVENGPTD
PSNSSTLHHLRPTDGTSGQNNKAGTGMSKSASFAFEFPKDRSGIETFSPPPPPPKSRHLL
KMNKSSSDLEKVSHGSAESLSPSFRGIHVSFTTGSTDSLASDSRTCSDGGTSSEPPHSPI
SSGKKLFAPVPFPSGSAEDMAPSGPLQPPPLPQKKLVSRAASSPDGFFWTQGSPKPRTAS
PRLNLSHSETNVCVHEESHFGDSSGPGHHHQHIFSASEPLEKTFKGSGHWGPARGLAGSG
SLQGKGVTSASASQLSVSGQASAGSTQLQLHSLLSSIGSREGTYAKLGGLYAQSLVRLVA
KCEDLFMGGQKKELHFSENNWSLFKLTCNKPCCDSGDAIYYCATCSEDPGSTYAVKICKT
PEPKAASYCSPSVPVHFNIQQDCGHFVASVPSSMLTSPDAPKVPLPALPSHPPSQEQDCV
VVITREVPHQTASDFVRDSATSHQSEPEVYERRVCFLLLQLCNGLEHLKEHGIIHRDLCL
ENLLLVHCAXQASPGPSPAPSAPPISSAAASSAPPTTISPAPAATPSSCPSAALPASVTP
TPPAAPACQGGPSEKHLPRLIISNFLKAKQKPGSTTNLQQKKSQARLAPEIVSASQYRKF
DEFQTGILIYELLHQPNPFEVRAQLREQDYRQEDLPPLPALSLYSPGLQRLAHLLLEADP
IKRIRINEAKRVLQCLLWGPRRELVEQPGTSEEVLCTTLNNWIDMKRALMMMKFAEKAVD
RRRGVELEDWLCCQYLASAEPVALLQSLKLLQLL
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagaccatcccactgaaccccgagagcccaaaaatgtccgcgtgcagcgacttt
gtggagcacatctggaagcccgggtcctgcaaaaactgcttctgcctgcgcagcgaccac
cagctggagcccggccgcccccagccccgagcgagcagcctgccccctccgcctcgcttg
ccccccaggcccgagaacgggcgcccggaggatgacagcctgagcagctcgccctactcc
aagcccaccattgctgtgaagcccaccatgatgagctccgaggcctctgatgggtggacg
gagcccggcgtgagtgctgacgtggcacaggtcatctggagacgagcccccggcaagctc
cccctcccgaagcaggaagatgtgccactagtttacctgggcagcttccgaggtgtccag
aagtctgctgggtcctcggcccctgcagacagccagccttgctgcccccctgcctgtgcc
atggtcggcctacacagcatagagccccggggggaacggaatgcctccttccacccgctg
agcttcccagatgagaagcttggccaagaggataaacccacgattccctaccaagagctg
acctccacccaggagagcttccgccagaaacttgctgcctttgctgggatgacatctggc
tgccacaagggctccgggtcctacccctctgcccaacccctgcgggagtccctgccctcg
gaggatgacagcgatcaaaggtgctcaccctcaggggacagcgaagggggagaatattgc
tccatcctggagtgttgccccggcagcccaggagtagaggatacctcacaggccgagggc
tcccgacacagacatggcggcagggactgcttaccagcgtgctgggagcagggcgtgtgt
gcgaggccaaccccggaggagaagcgggctttgagcttccctagggagtgctgcagccag
ggcccggcagagaacccgccccgtctgggccccaaaaagcagtccctcacctcagaggct
gccagctcttcggatggtctctcctgtgggagtgtcagcagccgtgccagcagccccttg
agcccccacgtcgagagtgattactgctcccttatgaaggaacctgggtctgggaagcag
caggaccctggctgccacagggtggcctcgagcaggtgccttgggctgactgtggagccc
cagcccccagccccctccagggaggctgcacagcctgaacccatctatgctgagagcacc
aagaggaagaaagctgtttcaatgccttccaggccacaggccaaggcagaacaggcagca
gctgccnnccagggccaggtgcggacagcaaatacctgggctcagaaaacagccggccgg
ggccaggacaaggaaggctcagatatggccccccaggtggcagccaccatcacagtcatg
gcagcccacccagaagaggaccaccggacaatctacctgagcagcccagactcctcagtg
ggggtacagtggccacgtgggcccccgagccagacccctgaggcaggagaagagagccct
tcagcgggtcaggggcttagctccagggagagccaccatcttggtgccagtgagaacacg
cccaaagggagacctgccatcccccctaagctgtccaggagcagccctggagggtctccg
gtgtccccctctgcctccccactgtccgacctcagcgaagggaactccggtgtccctggg
ccccagcgtccatccaggggccctgctgaccccacttcttcctgccaggccaacagtgtc
cccaccagtgactctgtcagaggccccccatctggcaccaccacatcagccgaccagagg
cggccccggtaccagaccggggcctggagtcgccagtgccggatagaggaagaggaggag
gtggagcaggacttgctgagccaaagctggggaagagaggtggaaaatggccccacggac
ccctccaactcctccaccttgcaccacctccgccccacagatggcacctctgggcagaac
aacaaagctgggaccgggatgagcaaatcagcctcgtttgcctttgagttccccaaggac
agaagtgggattgagacattctcacctcccccgccacctcctaaatcacggcacctttta
aaaatgaacaaaagcagctctgatttggagaaagtgagccacggctccgccgagagcctt
agcccatccttcaggggtatccacgtcagcttcaccacaggctccaccgacagcctggcc
tcagactccaggacttgcagtgacggaggcacatcatctgagccgccgcactcacccatc
agcagtggaaagaagctctttgcccctgttccgttcccttcgggttcggctgaagatatg
gcccccagtggccccctgcagcccccacctctgccccagaagaagttagtgagtcgggct
gcctcttcgccagatggcttcttctggacccaaggctcccccaagccaagaactgccagt
cccaggctgaacctcagccactcggaaaccaatgtctgtgtccacgaggagtcccacttt
ggtgactcctcgggccccggccaccaccaccagcacatcttctccgcttccgagcctctg
gagaaaacgttcaaaggcagcggccactggggtcccgcccggggactggcgggcagcgga
agcctccagggcaaaggagtcacctcggcctcagcctcccagctgagtgtatctggccag
gcctctgcgggcagcacccagcttcagctccacagcctcttgagcagtattggcagcagg
gagggcacctatgccaagctgggggggctctacgcccagtccctggtccgcctcgtggcc
aagtgtgaggacctcttcatgggtggccagaaaaaggaactgcacttcagcgagaataac
tggtcccttttcaagctgacctgtaacaagccctgctgtgactcgggggatgccatttat
tactgcgccacctgttctgaggaccccggcagcacctatgctgtgaaaatctgcaaaacc
cctgagcccaaagcagcctcctactgcagtccttccgtgccagtgcacttcaacatccag
caggactgtggccactttgtcgcctccgtgccctccagcatgctcacctctccggatgca
cccaaggtccctctgcctgccctgccctcacaccccccttcccaggagcaggactgcgtg
gtggtcatcacccgagaggtgccccaccagaccgcctcggactttgtgcgggactcagcc
accagccatcagtctgagcccgaggtttacgagcggcgcgtgtgcttcctgctcttacag
ctctgcaacgggctggagcacctgaaggagcacgggatcattcacagagacctgtgcctg
gagaacctgctgctggtgcattgcgccncccaggcctcccctggcccctcccccgctccc
tctgcccctcccatctcctccgccgccgcttccagcgcccctcccaccaccatatcccct
gcccctgctgctaccccttcctcttgtccctctgccgccctcccagccagcgtcaccccg
accccgccagctgcccccgcctgtcagggagggcccagtgagaaacacttgccccgactc
atcatcagcaatttcttgaaggccaagcagaagccaggcagcaccaccaacctgcaacag
aaaaagagccaggcccgcctggcccccgagatcgtgtctgcctcccagtaccgcaagttt
gatgaattccaaacaggcatcctcatttatgagctgctccatcagcccaaccctttcgaa
gtgagggcccagctgcgggagcaggactaccgacaggaggacctacccccactgcccgcc
ctgtccctctactcgccaggcctgcagcggcttgcccacctgctgctggaggccgaccct
atcaagcgcattcgcatcaacgaggccaagcgagtgctgcagtgcctgctgtgggggccc
cggcgggagctggtagagcagccgggcacgtcggaggaggtgctgtgcaccacgctcaac
aactggatcgacatgaagcgggccctgatgatgatgaagttcgcggaaaaggccgtggac
cgccggcgtggggtggagctggaggactggctttgctgccagtatctggcatctgcagag
cccgtagcccttttacaatcgctgaagctcctgcagcttctgtga

DBGET integrated database retrieval system