KEGG   Sus scrofa (pig): 100621339
Entry
100621339         CDS       T01009                                 

Gene name
PIM2
Definition
(RefSeq) serine/threonine-protein kinase pim-2
  KO
K08806  proto-oncogene serine/threonine-protein kinase Pim-2 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05200  Pathways in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100621339 (PIM2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100621339 (PIM2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100621339 (PIM2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100621339 (PIM2)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   100621339 (PIM2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 100621339
NCBI-ProteinID: XP_003360359
Ensembl: ENSSSCG00000028964
UniProt: A0A4X1VJM5 I3L8X4
LinkDB
Position
X
AA seq 311 aa
MLTKPLQGLPVAPMTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRVTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETPEGFMLVLERPL
PAQDLFDYITEQGPLGEGRSRCLFAQVVAAVRHCHARGVVHRDIKDENILMDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSARPSLEEILLDPWMQTPAEDASLNTPKG
GSTPLAWSLLP
NT seq 936 nt   +upstreamnt  +downstreamnt
atgttgactaagcctctgcaggggctgcccgtggcccccatgacccccacgccgccgcca
ggaggcaaggatcgagaagcgttcgaggccgagtaccgactcggccccctcctgggtaag
gggggctttggcaccgtcttcgcaggacatcgcgtcacagaccgactccaggtggccatc
aaagtgatcccccggaatcgcgtgctgggctggtcccccttgtcagattcagtcacgtgc
ccactggaagtggcactgttatggaaggtgggtgcaggcggtggacaccctggtgtgatc
cgcctgcttgactggtttgagacaccagagggcttcatgctggtcctcgagcggcctctt
cctgcccaggatctctttgactacatcacagagcagggccctttgggcgaaggccgaagc
cgctgcctctttgcccaggtagtggcagccgttcgtcactgccacgcccgtggagttgtc
catcgtgacatcaaggatgagaacatcctgatggacctccgccggggctgcgccaaactt
atcgattttggttccggcgcccttcttcatgatgaaccctacactgactttgatgggaca
agggtgtacagccccccagagtggatctctcgtcaccagtaccatgcactcccagccact
gtctggtccctgggtatcctcctctacgacatggtatgtggggacattccctttgagagg
gaccaggagattctggaggctgagctccacttccctgcccacgtctccccagactgttgt
gccctaattcgccgatgcctggcccccaaaccatctgctcgaccctcactggaggagatt
ctgctggatccctggatgcagacaccagctgaggatgcatccctcaacactcccaaaggg
ggttccacccctttggcctggtccctactgccctaa

DBGET integrated database retrieval system