KEGG   Sus scrofa (pig): 100621666Help
Entry
100621666         CDS       T01009                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ssc01002]
    100621666 (TMPRSS9)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100621666 (TMPRSS9)
Peptidases [BR:ssc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100621666 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 100621666
NCBI-ProteinID: XP_020939842
Ensembl: ENSSSCG00000028363
LinkDB All DBs
Position
2
AA seq 1093 aa AA seqDB search
MEPTASDLQLVPGAAKDVETAGVTCSWAALSAVVATSIVIVTLGVLMASLSTQGVLVEHT
AELRGIRFACSLQQESSDYYRMLTPTLEALFVSSFEETELEASCLGCTVLSYQDGNGSVL
VHIRLRFLLQPLRTLRPGLEEELLQRGLHRRLQGHGLPLATYGTIASVWLTGSQRGLLTE
RDLKSGRCVGNAFSCGNSQCVTKVNPECDDTADCSDGTDEAHCDCGLQPGWRTVGRIVGG
VEAAPGEFPWQVSLRENNEHFCGAAVISARWLVSAAHCFNEFQDPTEWVVYAGTTYLSGL
EASTVRARVVRIITHPLYNSDTADFDVAVLELGGPLPFSRHVQPVCLPAATHVFPPRKKC
LISGWGYLKEDFLVKPEMLQKATVELLDQALCANLYGHSLTDRMVCAGYLDGKVDSCQGD
SGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDWILEAITLTSKPLAPTV
APTPPTPSTAWPTSPKSPVVDTHTKPTLAPSTAPLHLPTASKLQECGVRPALEKPTRIVG
GFSAASGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAHLGTASLSGI
SGSPVKMGLRRAVLHPQYNPSILDFDVAVLELARPLVFNKYVQPVCLPLAIQKFPVGRKC
MISGWGNTQEGNATKPDILQRASVGIIDQKACSALYNFSLTDRMICAGFLEGKVDSCQGD
SGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGVYTRITRLKGWIVDTMSSHPTPPLATT
RTLASSLATRTTAGPTVPGITASRPTPLATSRVTSQPANRTATAMTTTARGETPLPHVPK
PTMGIQLPDCGLAPAAALTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLLSA
AHCFDVYGDPKQWAAFLGTPFLSGADGQLERVVRIHKHPFYNVYTLDYDVALLELAGPVL
RSRLVRPICLPEPGPRPPDGARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPV
QISSRMLCAGFPQGGVDSCSGDAGGPLACRDPSGRWVLTGVTSWGYGCGRPQFPGVYTRV
AAVRGWIWQNIQE
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaccgccagtgacttacagctggtgcccggggcagccaaggatgtcgaaact
gcaggtgtcacatgctcctgggctgccctctcagctgtggtggccaccagcatcgtcatt
gtcaccctgggagtcctcatggcctccctctctacacagggcgtcttagtggagcacaca
gcggagctgcgagggatccggtttgcctgcagcttgcagcaggagagctctgattactac
cgcatgctgacgcccaccctggaggcactgtttgtcagcagctttgaggagacagagttg
gaggccagctgcctgggctgcactgtgctgagttaccaggacgggaatggcagtgtcctc
gtgcacatccggctgcgcttcctgctgcagcccctgcggacgctgaggccaggcctggag
gaggagttgttacagcggggcctccataggaggctgcagggccacggcctccccctggcc
acctatggcaccatcgcgtcagtgtggctcacaggaagccagagggggctgcttacagaa
agagacttaaaatcaggtcgctgtgtggggaatgccttttcctgtggaaacagccagtgt
gtgaccaaggtgaacccagagtgtgatgacaccgcggactgctccgatggaaccgatgag
gcccactgtgactgtggtttgcagcctggctggaggacagtcggcaggattgtgggtggt
gtggaagcggccccaggggagttcccttggcaagtcagcctccgtgaaaacaacgaacac
ttctgtggggctgctgtcatcagtgccaggtggctggtgtctgctgcccactgcttcaat
gagttccaagaccccaccgagtgggtggtctacgcgggtaccacctacctcagtggcctg
gaagccagcacggtgcgggcccgtgtggtccggatcatcacacaccccctgtacaactcc
gacacggctgacttcgacgtggcagtgctggagttgggcggccccctgcccttcagcagg
cacgtgcagcctgtgtgtctcccggctgccacccacgttttcccacccaggaagaagtgt
ctgatctccggctggggctacctcaaggaggacttcctggtcaagccagagatgctgcag
aaagccaccgtggagctgctggaccaggccctgtgcgccaatctgtacggccactcgctc
actgaccggatggtgtgtgctggctacctggatgggaaggtggattcctgccagggtgac
tcagggggccctctggtctgcgaggagccctccggcaggttcttcctggccggcatcgtc
agctggggaatcggctgcgcagaagccaggcgtccgggggtctacgcccgagttaccagg
ctgcgtgactggatcctggaggcgatcaccctgacgagcaagcctctggcccccacggtg
gcccccaccccccctacccccagcactgcctggcctaccagccccaagagcccagtggtt
gacacccacaccaaacccacgctggcccccagcactgcacctctccacttgcccacagct
tccaaactgcaagagtgtggggtcaggccagcactggagaagcccacccggatcgtgggc
gggttcagcgctgcctccggggaggtgccctggcaggtcagcctgaaggagggttcccgg
catttctgcggagccaccgtggtgggggaccgttggctgctgtcagccgcccactgcttc
aaccacacgaaggtggagctggtgcgggcccacctgggcaccgcatccctctcaggcatc
agtgggagccccgtgaagatggggctcaggagggcggtgctgcacccccagtacaacccc
agcatcctggacttcgacgtggctgtgctggagctggccaggcccctggtcttcaacaag
tacgtgcagcccgtctgcctcccgctggccatccagaagttccccgtgggccgcaagtgc
atgatctccggatggggtaacacgcaggaaggaaatgccaccaagcctgacatcctgcag
cgggcatccgtgggcatcatagaccagaaggcatgcagtgccctctacaacttctcactt
acggacagaatgatctgtgcggggttcctggagggcaaggttgactcctgccagggtgac
tctgggggccccctggcctgtgaagagacccccggcgtgttctatttggcggggattgtg
agctggggcatcggctgcgctcaagccaagaagccaggcgtgtacactcgaatcaccagg
ctgaagggctggatcgtggacactatgtcctcccaccccacgccaccactcgccaccact
cggacactcgccagcagtcttgccaccagaacaacagctggccccacagtcccagggatc
acagccagtagacccacacctctggccaccagcagggtgaccagccaacctgccaacagg
actgccacagccatgaccaccactgctaggggagagacaccacttccacatgtcccaaag
cccaccatgggcatccagctgccagactgcggcctggcaccagccgcagcactgaccagg
attgtgggtggcagtgccgctggccgaggggagtggccgtggcaggtgagcctgtggctg
cggcggcgggaacaccgctgtggagccgtgctggtggctgagaggtggctgctgtcagct
gcgcactgcttcgatgtctatggggaccccaagcagtgggcagccttcctgggtactccg
ttcctgagcggcgcagacgggcagctggagcgtgtggtgcgcatccacaagcaccccttc
tacaatgtctacacccttgactacgacgtggcgctgctcgagctggcgggacctgtgctc
cgcagccgcctcgtgcggcccatctgtctgcccgaaccagggcctcggcctcccgacggc
gcacgctgtgtcatcacgggctggggctccgtgcgtgagggaggctcaatggcaaggcag
ctgcagaaagcggccgtgcgcctcctcagcgagcagacatgccgccgcttctacccggtg
cagatcagcagccgcatgctatgcgctggcttcccacagggcggcgtggacagctgctcg
ggtgacgccgggggacccctggcctgcagggacccctccggccggtgggtgctaactggg
gtcaccagctggggttacggctgcgggcggccccagttcccgggcgtctatacccgggtg
gctgctgtgaggggctggatctggcagaacatccaggagtga

DBGET integrated database retrieval system