KEGG   Sus scrofa (pig): 100621798Help
Entry
100621798         CDS       T01009                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6 isoform X2
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05034  Alcoholism
ssc05165  Human papillomavirus infection
ssc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    100621798 (HDAC6)
  09164 Substance dependence
   05034 Alcoholism
    100621798 (HDAC6)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    100621798 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:ssc01009]
    100621798 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:ssc03019]
    100621798 (HDAC6)
   04131 Membrane trafficking [BR:ssc04131]
    100621798 (HDAC6)
   03036 Chromosome and associated proteins [BR:ssc03036]
    100621798 (HDAC6)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100621798 (HDAC6)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100621798 (HDAC6)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100621798 (HDAC6)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100621798 (HDAC6)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100621798 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 100621798
NCBI-ProteinID: XP_003360363
Ensembl: ENSSSCG00000025545
UniProt: I3LEZ7
LinkDB All DBs
Position
X
AA seq 1117 aa AA seqDB search
MTSTGQDSTTTRQRRSRHNPHSPPHDSSVTSKRGVKKGAGLRSSPNLADVKKKGRMKKLS
QAAEQDLIVGLQGLDLNLEARTPSGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLM
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YTCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVALAARYAQQ
KHDVQRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHLLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRSLAEGVSASLHTLLGDPCPLLEFPGAPCPSA
QASLSCALEALEPFWEVLVRSAETLEDEDTVEGDHVEEEEEPWQPPELPMLAWPVLQART
GLVYDQQMMDHYNLWDSHHPEMPQRILRIMRRLEELGLAGRCLALPARPATDAELLACHS
AEYVSRIRATEKMRTRELHREGANYDSIYICPGTFACAQLAAGAACRLVEAVLAGEVLNG
IAVVRPPGHHAERDSACGFCFFNSVAVAARHAQAISGHALRILIVDWDVHHGNGTQHLFE
EDPSVLYISLHRYDHGTFFPMGDEGASSQIGQAAGTGFTVNVAWNGPRVGDPEYLAAWHR
LVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPECYAHLTHLLMGLANGRIILILEGG
YNLISISESMAACTRSLLGDSPPLLTLLRPPLSRALASIAETTQIHRRYWRSLRVTKVED
KERPSSSKSFAKKPSQPAKPKPSKGMTAPKGDIPEAHTGKATSVSSVKVSPPGQTKSEAA
LVELTQDQSSKAATEEAVGGAKLIQSPPASGGDNQTPPASPRQGSTTLISPSKLVGNLGA
LELRNEVQESPKEEGLLGEAAGGQNMDNLMLMQVFGNQADTDQAMFYAVSPLLWCPHVVA
VRPVPEAGLDVTQPCQDCGALQENWVCLSCYQVCCGRYINAHMLQHHESSGHPMVLSYAD
LSTWCYPCQAYVHHEALLAVKNIAHQNKFGEGVPHSR
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaccggccaggattccaccacaaccaggcagcgaagaagtaggcacaacccc
cactcccccccacacgactccagcgtcacctcgaagcgaggtgttaaaaagggtgccgga
ctccgctccagccccaatctagcggatgtaaagaagaaaggcagaatgaagaagcttagc
caagcagccgagcaagacctaatcgtggggctccaagggctggatctgaacctggaggcc
aggacaccgtctggcactggcttggtgttggatgagcagctaaatgaattccactgcctc
tgggatgacagcttccctgaaggccctgagcggctccatgccatcaaggagcagctgatg
caggagggcctcctggaccgctgcgtgtcctttcaggcccgattcgccgaaaaggaggag
cttatgttggttcacagcctagagtacattgatctgatggagacgacccagtacatgaat
gagggggagctccgcgtcctagcagacacctatgattcggtttatctgcatccgaactca
tacacctgtgcctgcctggcctcaggctccgtcctcaggctggtggatgccgtcctgggg
gctgagatccggaatggcatggccatcatcaggcctcctggacaccacgcccagcacagt
cttatggacgggtattgcatgttcaaccacgtagccttggccgcccgctacgctcagcag
aagcatgacgttcagagggtccttattgtggattgggatgtgcaccatggtcagggaaca
cagttcacctttgaccaagaccccagcgtcctctatttctccatccaccgctatgagcag
ggtcggttctggccccaccttaaggcctctaattggtccaccacgggttttggccaaggc
cagggatacaccatcaatgtgccttggaaccaggtggggatgcgagatgccgactacatt
gctgctttcctgcacctcctgctgccagtcgcccttgagttccagccccagctggtcctg
gtagccgctggctttgatgccctccaaggggaccccaagggtgagatggccgccactccg
gcagggttcgcccagctaactcatctgctcatgggtctggcaggaggcaagttgatcctc
tcactggagggcggctacaacctccgctccctggctgagggcgtcagtgcctcactccac
acccttctgggagacccttgtcccttgctggagttcccgggcgccccctgtcccagtgcc
caggcgtcactatcctgtgctctggaagcccttgagcccttctgggaggtccttgtgaga
tctgctgagaccctggaggacgaggacaccgtggagggggaccatgtggaggaggaggag
gaaccatggcagccccctgagctaccgatgctggcgtggccggtgctgcaggctcgcaca
gggctggtctacgaccaacagatgatggatcactacaacttatgggacagccaccacccc
gagatgcctcagcgcatcctgcgtatcatgcgccgactggaggagctgggcctcgccggg
cgctgcctcgctctgcccgcccgtcccgccacggatgctgagctgcttgcctgccacagt
gctgaatacgtgagtcgcatccgggccacggagaagatgaggacccgggagctgcaccgc
gagggtgccaactatgactccatctacatctgccctggcaccttcgcctgtgcgcagctg
gccgcgggcgccgcctgccgcctggtggaggctgtgctggcaggagaggttttgaatggt
attgccgtggtgcgcccccctggacaccacgcagaaagggactcggcttgcggtttctgc
tttttcaattctgtggcagtagctgctcgccatgctcaggccatcagtgggcatgcgctg
cggatcctgatcgtggactgggacgtccatcatggtaacggcactcagcacttatttgag
gaggaccccagcgtgctctacatttccctgcaccgctacgatcatggcaccttctttccc
atgggggatgagggtgccagcagccagataggtcaggctgcaggcacgggcttcactgtc
aacgtggcctggaatgggccccgcgtgggtgaccccgagtacctggctgcatggcatcgg
ctggtgcttcctattgcctatgagtttaacccggaactggtgctggtctcagctggtttc
gacgctgcccggggggacccgctgggtggctgccaggtgtcacctgagtgctacgcccac
ctcacccacctgctgatgggcctggccaatggccgtattattctaatcctagagggtggc
tataacctgatatccatctcggagtccatggctgcctgtacccgctccctccttggggac
tcaccacccctgctgaccctgctgaggcccccactctcacgggccctggcctcgatcgcc
gaaaccacccaaatccatcgcagatactggcgcagcttgcgggtcacaaaggtcgaagac
aaagagagaccctccagttctaagtcgttcgccaagaagccatcccaaccagccaagcct
aagccatccaaggggatgaccgccccaaaaggggacattccggaagcacacacagggaag
gccacctcggtatcatcagtgaaagtgtcccccccaggccagacgaagtcagaggcagcc
ctagtggaacttactcaggaccagtcctcaaaggctgccacagaggaggctgtgggagga
gctaagctgatccaaagccctccagcctcgggaggtgacaaccagactcctccagcttct
ccacggcaaggatccacaactctgatctcccccagcaagctggtaggcaatctcggagcc
ttggaactgagaaatgaggttcaggagtccccaaaagaggaagggctgctaggagaggca
gctggaggtcagaacatggacaatttaatgctgatgcaggtctttggaaaccaagctgac
actgaccaggccatgttctatgctgtgtcaccactgctctggtgtccacatgtggtggca
gtacgccccgtacctgaagcgggcctggacgtgacccaaccttgtcaagactgtggagca
ctccaggagaactgggtgtgtctgtcttgctatcaggtctgctgcggccgttatatcaac
gcccatatgctccagcaccacgaaagctcaggccaccccatggtcctcagctacgccgac
ctgtctacctggtgttacccctgccaggcctatgttcaccacgaggctctcctggctgtg
aagaacatcgcccaccagaacaagtttggggagggcgtgccccactcccgctag

DBGET integrated database retrieval system