KEGG   Sus scrofa (pig): 100622296Help
Entry
100622296         CDS       T01009                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00480  Glutathione metabolism
ssc00980  Metabolism of xenobiotics by cytochrome P450
ssc00982  Drug metabolism - cytochrome P450
ssc00983  Drug metabolism - other enzymes
ssc01524  Platinum drug resistance
ssc05200  Pathways in cancer
ssc05204  Chemical carcinogenesis
ssc05225  Hepatocellular carcinoma
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100622296 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100622296 (MGST2)
   00982 Drug metabolism - cytochrome P450
    100622296 (MGST2)
   00983 Drug metabolism - other enzymes
    100622296 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100622296 (MGST2)
   05204 Chemical carcinogenesis
    100622296 (MGST2)
   05225 Hepatocellular carcinoma
    100622296 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100622296 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    100622296 (MGST2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100622296 (MGST2)
Transporters [BR:ssc02000]
 Other Transporters
  Pores ion channels [TC:1]
   100622296 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 100622296
NCBI-ProteinID: XP_020956337
Ensembl: ENSSSCG00000009059 ENSSSCG00000029674
LinkDB All DBs
Position
8
AA seq 146 aa AA seqDB search
MAENSILLAVLSLLSACQQSYFALQVGKARLKYKVMPPAVSGSPEFERIFRAQQNSLEFY
PVFIITLWVAGWYFNQVFATCLGLVYIYARHRYFWGYSEAPKKRITGFRLSLGVLALLAV
LGAVGITNSFLDEYLDLNIAKKLRHF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaattcgatcttgctggctgttctctcgctcctctctgcctgtcagcaaagt
tattttgctttgcaggtaggaaaggcaagattaaaatacaaagtgatgcctccggctgtc
tctgggtcgccagagtttgagagaatatttcgtgcacaacaaaactctttagagttttac
ccagtattcattattacattgtgggtggctggatggtatttcaaccaagtttttgccact
tgtctgggtctggtgtacatctatgcccgtcaccggtatttttggggatattcagaagct
cctaaaaaaaggatcactggtttccggttaagtctgggggttttggccttgttggccgtc
ctaggtgctgtggggattacaaacagctttctggatgaatatctggacctcaatattgcc
aagaaactgaggcacttctaa

DBGET integrated database retrieval system