KEGG   Sus scrofa (pig): 100622482Help
Entry
100622482         CDS       T01009                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04110  Cell cycle
ssc04213  Longevity regulating pathway - multiple species
ssc04330  Notch signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc05016  Huntington disease
ssc05034  Alcoholism
ssc05165  Human papillomavirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100622482 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100622482 (HDAC1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100622482 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100622482 (HDAC1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    100622482 (HDAC1)
   05202 Transcriptional misregulation in cancers
    100622482 (HDAC1)
   05203 Viral carcinogenesis
    100622482 (HDAC1)
   05220 Chronic myeloid leukemia
    100622482 (HDAC1)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    100622482 (HDAC1)
  09164 Substance dependence
   05034 Alcoholism
    100622482 (HDAC1)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    100622482 (HDAC1)
   05165 Human papillomavirus infection
    100622482 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100622482 (HDAC1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100622482 (HDAC1)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100622482 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100622482 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100622482 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100622482 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100622482
NCBI-ProteinID: XP_013854570
Ensembl: ENSSSCG00000029450
LinkDB All DBs
Position
6
AA seq 482 aa AA seqDB search
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDCFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctccttaactatggtctctaccggaaaatggaaatctatcgccctcacaaggccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaattcctgcgctccatccgc
ccagataacatgtctgagtacagcaagcaaatgcagagattcaacgttggtgaggactgt
ccggtgtttgatggcctgtttgagttctgtcagctgtctgctggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaactgggctgggggcctacac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgagtcatgactgtgtcctttcataaa
tatggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaag
tattatgctgttaactacccgctccgagatgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgcggtcgtcttacag
tgtggctctgactccctgtctggggatcggttaggttgcttcaatttgaccatcaaaggg
cacgccaagtgtgtggagtttgtgaagagcttcaacctacctatgttgatgctgggagga
ggtggctacaccattcgtaatgtcgcccggtgctggacatatgaaacagctgtggccctg
gacacggagatccctaatgagcttccgtacaacgactgctttgaatacttcggaccagat
ttcaaacttcacatcagtccttccaatatgactaaccagaacactaatgagtacctggaa
aagatcaaacagcgactgtttgagaacctgagaatgctgccccatgcacctggggtccaa
atgcaggccattcctgaggatgccattccagaggagagtggcgatgaggatgaagaagac
cctgacaagcgcatctcaatctgttcctcggacaaacgaattgcctgtgaggaagagttc
tctgactctgatgaggagggagaaggtggtcgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaagatgagaaagagaaggacccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system