KEGG   Sus scrofa (pig): 100623280
Entry
100623280         CDS       T01009                                 

Gene name
PTCH2
Definition
(RefSeq) protein patched homolog 2 isoform X1
  KO
K11101  patched 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04340  Hedgehog signaling pathway
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100623280 (PTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100623280 (PTCH2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100623280 (PTCH2)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 100623280
NCBI-ProteinID: XP_020952419
LinkDB
Position
6
AA seq 1275 aa
MAGPPPLGELPPGYASPDGSAAPQILAGSLKAPLWLRASFQGLLFSLGCAVQRHCGKVLF
LGLLAFGALALGLRVAVIETDLEQLWVEAGSRVSQELQYTKEKLGEEAAYTSQMLIQTPR
QEGENVLTPEALGLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMVEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPEHLLEELGPFASLEGFRELLDK
AQVGQAYVGRPCLHPDDLHCPPSAPNHHSRQAPNVAQELSGGCHGFSHKFMHWQEELLLG
GMARDPQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQAGTVLQAWQRRFV
QLAQEALPGNASQQIHAFSAATLDDILHAFSEVSATRVVGGYLLMLAYACVTMLRWDCAQ
SQGAVGLAGVLLVALAVASGLGLCALLGIAFNAATTQVLPFLALGIGVDDIFLLAHAFTE
APPGTPLQERTGECLQRTGTSVALTSINNMVAFFMAALVPIPALRAFSLQAAIVVGCNFA
AVMLVFPAVLSLDLHRRHCQRLDVLCCFASPCSARVIQILPQELGDGTVPVGIARLTATV
QAFAHCEASSQHVVTILPPQTHLVPPPSDPLGSELFSPGGSTRDLLGQEEGTRQKAACKS
LSCAHWNLAHFARSQFAPLLLQPHAKAMVLVLFGALLGLSLYGATLVQDGLALTDVVPRG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRNWLQEIQAAFDQDWASGRITRHSYRNGSEDGALAYKLLIQTGDAQEPLDFSQLT
TRKLVDQEGLIPPELFYVGLTVWVSSDPLGLAAAQANFYPPPPEWLHDKYDTTGENLRIP
AAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEAGRAGVRAYPSGSPFLFWEQYLGL
RRCFLLAICLLLAGTFFVCALLLLSPWTAALIVLVLAMMTVELFGIMGFLGIKLSAIPVV
ILVASVGIGVEFTVHVALGFLTAQGSQNLRAARALEHTFAPVTDGAVSTLLGLLMLAGSN
FDFIVRYFFVVLTVLALLGLLHGLVLLPVLLSILGPPPEVTTPAFCSRPAGWGGKGKGRD
RDRTGGAQWPTDGAQLTRTPPHEVPPTEGGILPFCPDRQHVPLPQTPSKTHLSLSGSRAG
CRVCPRPNILSLISSHILLEATGGPQEPELTGADVSPARSYRCTRRAQRSRAPRLHGQEG
SGGNCHPPCPRALPE
NT seq 3828 nt   +upstreamnt  +downstreamnt
atggctggaccgccacccctcggggagctacccccgggctacgcatccccagatggatct
gcagcaccccagatcctagctgggagcctgaaggctcccctctggctgcgtgcttccttc
cagggcctgctcttctctctgggctgcgcggtccagagacactgtggcaaagtactcttc
ctgggactgttggcctttggggccctggcactgggcctccgcgtggccgtcattgagaca
gacctggaacagctctgggtggaagccggcagccgggtgagccaggagctgcaatacacc
aaggagaagctgggggaggaggcggcgtacacctcgcagatgctgatacagaccccgcgc
caggagggggagaacgtcctcacgcccgaggcccttggcctccacctccaggcagccctc
accgccagtaaagtgcaagtgtccctctatggaaagtcctgggacttgaacaaaatctgc
tataagtctggagttcccctaattgaaaacggaatgatcgagcggatggtcgagaagctg
ttcccgtgcgtgatcctcacccccctcgactgcttctgggagggagccaaactccaaggg
ggctctgcctacctgccgggccgccccgacatccagtggaccaacctggatccggagcac
ctactggaggagctgggcccctttgcctccctcgagggcttccgggagctgctggacaag
gcacaggtgggccaggcctacgtggggcggccctgtctgcaccctgacgacctccactgc
ccgcctagtgcccctaaccaccacagcaggcaggctcccaatgtggctcaggagctgagc
gggggctgccacggcttctcccacaagttcatgcactggcaggaggaactgctgctgggg
ggcatggccagggacccccaaggacagctgctgagggcagaggccctgcagagcaccttc
ctgctgatgagcccccgccagctgtacgagcacttccggggcgactaccagacccacgac
atcggctggagcgaggagcaggccggcacggtgctgcaggcctggcagcggcgcttcgtg
cagctggcccaggaggccctgcctgggaacgcgtcccagcaaatccacgccttctccgcc
gccaccctggacgacatcctacacgccttctccgaagtcagcgccacccgtgtggtggga
ggctacctgctcatgctggcctacgcctgcgtgaccatgctgcggtgggactgtgcccag
tcccagggagctgtgggccttgccggggtgctgctggtggccctggcggtggcctcgggc
ctcgggctctgtgccctgctcggcatcgccttcaatgctgccactacccaggtgctgccc
ttcttggcactgggaatcggcgtggatgacatattcctgctggcacatgccttcacagag
gctccgcctggcacccctctccaggagcgcaccggtgagtgtctgcagcgcacgggcacc
agcgtcgcgctcacgtccatcaacaacatggtggccttcttcatggccgccctcgtgccc
atccctgccctgcgggccttctccttgcaggcggccatagtggtcggctgcaacttcgca
gccgtgatgcttgtcttcccggcggtcctcagcctggacctgcaccggcgccactgccag
cgccttgatgtgctctgctgcttcgcaagcccctgctctgctcgggtgattcagattctg
ccccaggagctgggggatgggacagtacccgtgggcattgcccgcttgactgccaccgtt
caagcctttgcccactgtgaagccagcagccagcatgtggtcaccatcctgcctccccaa
acccacctggtgcccccaccttctgaccctctgggctctgagctcttcagcccgggaggg
tccacacgggaccttctaggccaggaggaggggacacggcagaaggcagcctgcaagtcc
ctgtcctgtgcccactggaatcttgcccatttcgcccgctctcagtttgcacccttgctg
ctccaaccccatgccaaggccatggtgctggtactttttggggctcttctgggcctgagc
ctctatggagcaaccttggtgcaggatgggctggccctgacagatgtggtgcctcggggc
accaaggagcatgccttcctgagcgcccagctcaggtacttctccctgtacgaggtggcc
ctggtgacccagggtggctttgactacgcccactcccaacgcgccctctttgatctgcac
cagcgcttcagttccctcaaggccgtgctgcccccaccggccacccaggcgccccgcacc
tggctgcactattaccgcaactggctccaggaaatccaggctgcgtttgaccaggactgg
gcttccgggcgcatcacccgccactcgtaccgcaatggctccgaggatggcgccctggcc
tacaagctgctcatccagaccggggatgcccaggagcctctggatttcagccagctgacc
acgaggaagctggtggaccaggaggggctgattccacccgagctcttctacgtggggctg
accgtgtgggtgagcagcgaccccctgggtctggcagccgcgcaggccaacttctacccc
ccgcctcccgagtggctgcatgacaagtatgacaccaccggggagaaccttcgcatcccg
gcggcccagcccttggagttcgctcagttccctttcctactgcgcggcctccagaagacc
gcagacttcgtggaggccatcgagggggcccgggcagcatgtgctgaggcaggccgggct
ggggtgcgtgcctaccccagcggctccccgttcctcttctgggagcagtacctgggcctg
cgacgctgcttcctgttggccatctgcctcctgctggcgggcactttcttcgtctgcgcc
ctgctgctgcttagcccctggacggctgccctcatcgtgctggtcctggcgatgatgacc
gtggagctctttggcatcatgggtttcctgggcatcaagctgagcgccatccccgtggtg
atcctggtggcgtctgtgggcatcggtgtcgagttcactgtccacgtggctctgggcttc
ctgaccgcccagggtagccagaacctgcgggctgcccgcgccctggagcacacattcgcc
ccggtgaccgatggcgccgtctccacgttgctgggtctgctcatgcttgctggttccaac
tttgacttcatcgtcaggtacttcttcgtggtgctgacagtcctcgcgctgctgggcctc
ctccacgggctggtgctgctgcctgtgctgctgtccatcctgggccccccgccagaggtg
accacacccgccttctgctcccggcccgcaggatggggcgggaaaggcaaggggagggac
agagacaggacagggggcgctcagtggccaacagacggggctcaactcacaaggacacct
ccccatgaggtgccaccaactgaaggtggcatcctccccttttgcccagacagacaacat
gtccctctcccccagactccttcaaagacccaccttagcctttcggggtcccgagcaggg
tgcagggtttgccccaggcccaacatcctgtccttgatcagctctcacatcctgctggaa
gccaccggaggaccccaggagcccgagctcactggggctgatgtctcccctgccaggtcg
tacagatgtacaaggagagcccagaggtcacgagccccccggctccacgggcaggagggc
tcaggtgggaactgccacccaccttgcccgagagctttgccagagtga

KEGG   Sus scrofa (pig): 100627504
Entry
100627504         CDS       T01009                                 

Gene name
PTCH1
Definition
(RefSeq) protein patched homolog 1 isoform X1
  KO
K06225  patched 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04024  cAMP signaling pathway
ssc04340  Hedgehog signaling pathway
ssc04360  Axon guidance
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100627504 (PTCH1)
   04024 cAMP signaling pathway
    100627504 (PTCH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100627504 (PTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100627504 (PTCH1)
   05205 Proteoglycans in cancer
    100627504 (PTCH1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100627504 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 100627504
NCBI-ProteinID: XP_003482848
Ensembl: ENSSSCG00000027312
UniProt: I3LVF2
LinkDB
Position
10
AA seq 1452 aa
MASAGNAAEPQDLGSGGSGGSCSGAPGRPAGGGRRRRTGGLRRNAAPDRDYLHRPSYCDA
AFALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKA
ANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALRQH
LDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEG
AKLQSGTAYLLGKPPLQWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLN
PADPDCPATAPNKNTTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAH
ALQTMFQLMTPKQMYEHFKGYEYVSHISWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQK
VLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVA
LSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTG
ECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSM
DLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTETHDNTRYSPPPPYSSHSFAHETQITM
QSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTLAQDTLSCQSPESTSSTRDLLSQFSDS
SLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLT
DIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHKSFSNVKYVMLEENK
QLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPID
ISQLTKRRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPE
TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICNNYTSLGLSSYPNGYPFLFW
EQYIGLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIVTVLALMTVELFGMMGLIGIKL
SAVPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVL
MLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSP
EPPPSVVRFAVPPSHANNGSDSSDSEYSSQTTVSGISEELRAYEAQQGTGGPAHQVIVEA
TENPVFARSTVVHPEPRHHPPPNPRQQPHRDSGSLPPGRPGQQPRRDPSREGSRPPPYRP
RRDAFEISTEGHSGPSHRDRAGPRGARSHNPRHSAFTTTGGSAPGYCQPITTVTASASVT
VAVHPPPAPGSSRNPRGGLCPGYEGYPETDPGLFEDPHVPFNVRCERRDSKVEVIELQDV
ECEERPRGSGSN
NT seq 4359 nt   +upstreamnt  +downstreamnt
atggcttcggctggtaatgccgccgagccccaggacctcggcagcggcggcagcggcggc
agctgcagcggagccccgggccggccggccggcggcgggaggcgcagacggaccgggggg
ctgcgccgcaacgccgcgccggaccgggactatctgcatcggcccagctactgcgacgcc
gccttcgctctggagcagatttccaaggggaaagctactggccggaaagcgccgctgtgg
ctgagagcgaagtttcagagactcttatttaaactgggttgttacattcaaaaaaactgc
ggcaagttcttggttgtaggcctcctcatatttggggccttcgctgtgggattaaaggca
gctaatctcgagaccaacgtggaggagctgtgggtggaagttggtggacgagtaagtcgt
gaattaaattatacccgccagaagattggagaagaggctatgtttaatcctcaactcatg
attcagacccccaaggaagaaggtgctaacgtcctgaccacagaagctctccgacagcac
ctggactcggcgctccaggccagccgggtgcatgtatatatgtataacaggcagtggaaa
ttggaacatttgtgttataaatctggagaacttatcacagaaacaggttacatggatcag
ataatcgaatatctttacccttgtttaattattacacctttggactgcttctgggaaggg
gcgaagttacagtctgggacagcctacctactaggtaagcctcctttgcagtggacaaac
tttgaccctttggaattccttgaagagttaaagaaaataaactatcaagtggacagctgg
gaggaaatgctgaataaggctgaggttggtcatggttacatggaccggccctgcctcaat
ccggctgatccagactgccctgccacagcccccaacaaaaatacaaccaaacctcttgat
atggcccttgttttgaacggtggatgtcatggattatccagaaagtatatgcactggcag
gaggaactcatcgtgggtggcacagtcaagaacagtactggaaagcttgtcagcgcccac
gccttgcagaccatgttccagttaatgacccccaagcagatgtacgaacacttcaagggg
tatgagtacgtctcgcacatcagctggaacgaggacaaggcggccgccatcctggaggct
tggcagaggacatacgtggaggtggttcatcaaagtgtcgctcagaactccactcagaag
gtgctctcctttaccacaacgaccctggacgacatcctcaagtccttctctgatgtcagc
gtcatccgagtggccagtggctacttactgatgcttgcctatgcctgtttaaccatgctg
cgctgggactgctccaagtcccagggtgccgtggggctggctggcgtcctgttggttgca
ctgtcagtggctgcaggattgggcctgtgctcattgatcgggatctcctttaatgctgca
acaactcaggttttgccatttctcgctcttggtgttggcgtggatgatgttttccttctg
gcgcatgcatttagtgaaacaggacagaataaaagaatcccttttgaggacaggactgga
gaatgcctcaagcgcaccggagccagcgtggccctcacatccatcagcaatgtcacagcc
ttctttatggccgcattaatccccatccctgctctgcgggccttctccctccaggcggct
gtagttgtggtgttcaattttgctatggttctgctaattttccctgcaattctcagcatg
gatttgtatcgacgagaggacaggagattggatattttctgctgttttacgagcccctgt
gtcagcagagtgattcaggtcgaaccccaggcctacacagagacgcacgataacacccgc
tacagccccccgcccccctacagcagccacagcttcgcccacgaaacccagatcaccatg
cagtctacagtgcagcttcgcacggagtacgatccccacacacacgtgtactataccact
gccgagccgcgctccgagatctctgtgcagcctgtcaccctggcccaggacaccctcagc
tgccagagccccgagagcaccagctccacgagggacctgctgtcccagttctcagactcc
agcctccactgcctcgagcccccctgcaccaagtggacgctctcctcttttgctgagaag
cactatgcgcctttcctcttgaaacccaaagccaaggtcgtggtgatcttcctcttcctg
ggcctgctgggggtcagcctgtatgggaccacccgagtgcgtgatggactggaccttaca
gacatcgtgcctcgggaaacgagagaatacgacttcattgctgcacagttcaagtacttc
tctttctacaacatgtatatcgtcactcagaaagcagactaccccaacatccagcactta
ctttatgaccttcacaagagcttcagtaacgtgaagtatgtcatgttggaagaaaataaa
cagcttcccaaaatgtggctgcactacttcagagactggctccaaggacttcaggatgcg
tttgacagtgactgggaaactgggaaaatcatgccaaacaattataaaaatggatcagat
gatggggtccttgcctacaaactcctggtgcaaactggcagccgcgataaacccatcgac
atcagtcagctgacgaagcgacgtctggtggatgccgacggcatcattaacccgagtgct
ttctacatctacctgactgcttgggtcagcaacgaccccgtggcgtacgccgcctcccaa
gccaacatccggcctcaccgtcccgagtgggtccacgacaaagccgactacatgcccgaa
accaggctgagaatcccagcagcagagcccatcgaatacgcccagttccccttctacctc
aacggcctgcgggacacctcggacttcgtggaagccattgaaaaagtcaggaccatctgc
aacaactacacgagcctggggctctccagctaccccaacggctaccccttcctcttctgg
gagcagtacatcggcctccgccactggctcctgctgtccatcagcgtagtgctggcctgc
acgttcctcgtgtgtgctgtcttcctcctgaacccctggacggccgggatcattgtgacc
gtcttggctttgatgacagtcgagctcttcggcatgatgggcctcatcggaatcaagctg
agcgccgtgcccgtggtcatcttgatcgcttccgtcggcatcggagtggagttcaccgtt
cacgttgctctggcctttctgacagccattggcgataagaaccgcagagccgtgctggcc
ctggagcacatgtttgcgcccgttctggacggtgctgtctccactttgctgggagtgctg
atgcttgctggatctgagtttgatttcattgtcaggtatttctttgctgtcctggcgatc
ctcacaatcctgggggttctcaatggactggttctgctgcccgtccttttgtccttcttc
ggaccgtatcctgaggtgtctccagccaacgggctgaaccggctgcccaccccttcccca
gagccaccccccagcgtggtccggtttgctgtgcccccgagtcatgccaacaacgggtct
gattcctctgactcggagtacagttctcagacgacagtgtccggcatcagcgaagagctt
cgggcctacgaggcccagcagggcactgggggccctgcccaccaagtgatcgtggaagct
acagaaaaccctgtctttgcccgctccaccgtggtccatcctgaaccgagacatcaccca
cccccgaaccctcggcagcagcctcaccgggactcagggtccctgccacccggacgacca
ggccagcagccacgaagagacccctccagggaaggctcgaggccgcccccctacagaccg
cgcagagacgctttcgaaatttctactgaagggcattcgggccctagccacagggaccgc
gcgggcccccgcggggcccgttcccacaaccctcggcactcagcgttcacaaccacgggc
ggctctgcccccggctactgccagcccatcaccaccgtgacggcctcggcctccgtgacc
gtcgctgtgcaccccccgcccgcccccgggtccagtcggaacccccgcggggggctctgc
ccaggctacgagggctaccccgagactgaccccgggctgtttgaggacccccatgtgcct
tttaatgtccggtgcgagaggagggattccaaggtggaagtcattgagctgcaggacgtg
gagtgtgaggagaggccccggggcagtggctccaactaa

DBGET integrated database retrieval system