KEGG   Sus scrofa (pig): 100623494Help
Entry
100623494         CDS       T01009                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351 isoform X1
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00052  Galactose metabolism
ssc00500  Starch and sucrose metabolism
ssc01100  Metabolic pathways
ssc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100623494 (MGAM2)
   00500 Starch and sucrose metabolism
    100623494 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100623494 (MGAM2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100623494 (MGAM2)
    3.2.1.20  alpha-glucosidase
     100623494 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100623494
NCBI-ProteinID: XP_020934752
LinkDB All DBs
Position
18
AA seq 2506 aa AA seqDB search
MARKFSILEILLIIFVLIILAVDILLLLLVLENPSDASFIPECPEVPEAERIDCAPGQEV
TEDVCRWRYKCCWKPVANTDIPWCFFPRNWGYEVSSWVKNTSTVLSAQLRRLPSPSLFGN
DVIDTLFTAEYQTSNRFHFKVTDFNNIRYEVPHESVRLFDDGAADTSNSSYHVEIVNKPF
SVKIMRTSNQRVLLDTSIGPLQVAQQYLQLSFRLPSANVYGLGEHVHQQYRHSMAWRTWP
IFTRDATPTQGMINLYGAHPFFLCLEDTSGYSFGVFLMNSNAMEVTLQPAPAITYRTTGG
ILDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRDYGGIDGLKKVVNRNRAAE
IPYDVQYSDVDYMDGKKDFTVDGVAFYNLSGFVRELHSYGLKYVIMMHPGIVNNSDYPPY
VNGREKRVWILGNKGAVIGQGYPGWTVFPDFSNPACTEWWKDQFVEFNSTLEFDGVWIEM
DEVSSFLQSPDHECELNNLNFPPFTPRVVDRLLFARTLCMDAEFHEGLHYDVHSLYGYFM
ARATDRAMEAILSNKRGFILSRSTFAGSGTFAGHWLGDNAATWDDLRWSIPSILEFNLFG
IPMVGANICGYTENVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFSENNSTLLNSA
RHYLNIRYTLLPYLYTLFYRAHSLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPV
LYEGVDSAKAYIPDAIWYDYETGVATQWRKQFVEMLLPGDRIGLHLRGGYIFPTQQPNTT
TEASRRNSLGLIIALDYKREAKGQLYWDDGESKDAVAQNKYILYDFSVTSNRLQAKIIKN
TYTDPNGLTFTNITILGMDKEPANFTVFLNNAATPISNVVYTSSTKVVSIPDLQGLLLGQ
EFSIEWNLPVHDLQKFNCYPEEPAVSEENCQQRGCLWEPTTVPGVPTCFYDTIPNYAASN
IQYLPTGITTDLSHLTAPESAAPPSSRGEQIQPPVAAAAAKAASASDPLSAKISFLRVSV
IYHTATMLQFKIYDPTNKRYEVPVSLNTPPSPVGSTADRLYDVRIQNNPFGIQIRRKSSG
TVIWDSQLPGFTFNDLFLSISTRLPSQYLYGFGETEHTTFRRNMSWHMWGMFARDEPPAY
KKNSYGVHPYYMALEGDGNAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTP
ELVTQQYTELIGQPAMVPYWALGFQLSRYGYQNDAEISNLYDAMVAAQIPYDVQHVDIDY
MDRKLDFTLSPSFQNLGLLIEQMKKNGMRFILILDPAISGNETQYLTFTRGQENNVFIKW
PDNSDIVWGKVWPDLPNVNVDGSLDPDTQVKLYRAHVAFPDFLRNSTAAWWKKEIEELYR
NPREPEKSLKFDGLWIDMNEPSNFVDGSVTGCSDDVLNNPPYMPHLESRDGGLSNKTLCM
ESQQILPDGSPVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWSGHWL
GDNTAAWDQLRKSIIGMMEFSLFGVPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNH
NTFGTRRQDPVAWNSTFEMFSRKVLQTRYALLPYLYTLMHKAHVEGSTVVRPLLHEFTKD
ATTWDIDQQFMLGPAVLISPVLESNTFQILAYFPRARWYDYSTESGSESPGEWKILAAPL
DHINLHIRGGYILPWQEPAMNTFSSRQKFMGLIVALDSSGRADGQIFWDDGQSIDTYENG
NYFLANFTAAQNVLQIQTIHNKYLSDSNPLKVGYIRIWGINSTYVTQVTLTYDNQQFVVM
TFKSDPYNQTLTIQLTDKIISLEKLTEISWIHGGPIVSTTPMMSTFPKSSSYPPTFTTRA
TPSETISTSSATTSTATASSIVTLPVTTTPFLTNATQVPTGTTVPDNVTSSPTNATSAGI
IVTLPVTITSFPTGTPEVPPGTTDLNNITSSPTNITTASTDVTLPVTPTPFPTGTPEVPP
GTTDLNNITSSPKNITTASTDVTLPFTPTPFPTGTPEVPTGPSILNTTTSSPTNTTTPST
NVTPPVTIMPFPTSTTEISTGTTVPANTTASPTNATTASADVTLPVTTTPFLTNATQVPT
GTTVPDNVTSSPTNITTASTDVTLPFTPTPFPTATPEVPTGPSILNTTTSSPTNTTTPST
NVTPPVTIMPFPTSTTEISTGTTVPANTTASPTNATTASADVTLPVTTTPFLTNATQVPT
GTTVPDNVTSSPTNTTTAGTVVTLPVTTTPFLTNATQVPTGTTVPDNVTSSPTNTTTAGT
VVTLPVTTTPFPTSTPEVPTGTSILNTTVSSPTNTTTPSTNVTPPVTIMPFPTSTTEISI
GTTVPDNTTASPTNATTASADVTLPVTTTPFLTNATQVPTGTTVPDNVTSSPTNATSAGI
IVTLPVTITSFPTGTPEVPPGTTDLNNITSSPTNITTASTDVTLPVTPTPFPADTSEVPT
GPSILNTTTSSPTNTTTPSTNVTLSVTIMLPTILLKFQLVRLILIT
NT seq 7521 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagtttagcatattggaaatccttctgatcatctttgtcctaattatattg
gccgtagatatcctcttgctgcttctcgtgttggaaaatccttcagatgcttcatttatt
ccggagtgtccagaagtccctgaagcagaaaggatagactgtgctcccggccaggaggtg
acagaggatgtctgcagatggagatataagtgctgctggaagcctgtcgcaaacactgat
atcccttggtgcttcttccccagaaactggggctatgaagtcagcagttgggttaaaaat
acaagcacagtgctttctgcccagttgagaaggttgccgtccccgtccctgtttggaaat
gacgtcatcgacaccctcttcacagctgagtaccagacatccaatcgttttcatttcaag
gtcactgatttcaataacatacgctatgaagtcccccatgaaagtgtcaggctgttcgac
gatggggctgctgatacctccaattcgagctatcacgtagaaatcgttaacaaacccttc
agcgtcaaaattatgaggacgagcaaccagagagtcttgctggacacaagcatcgggccc
ctccaggttgcccagcagtatctgcagctgtccttccggctacccagcgccaacgtgtac
gggctgggagaacacgtgcaccaacagtaccgccacagcatggcctggaggacctggccc
atcttcacccgggatgccacccccacccagggtatgattaatctgtatggagctcaccca
ttcttcctgtgccttgaagacaccagcggctactcttttggggtttttctgatgaacagt
aatgccatggaggtcaccctccagcccgctcctgctatcacttatcgtaccactgggggc
attctcgacttctacgtgttcctgggaaatactccagaacaggtggttcaggagtatctg
gagcttgttggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgt
agggattatggtggcatcgacgggttgaaaaaagttgtaaaccgaaatcgtgcagctgag
atcccatatgatgtccagtactctgatgtagactacatggatggaaagaaggatttcact
gttgatggagtggctttctataatctctcaggttttgtcagagagttacatagctatgga
ttgaaatatgtaattatgatgcatcctggcatcgtaaataactctgactaccctccttat
gtgaatggaagagaaaagagagtgtggatcttggggaacaaaggtgctgtcattgggcag
gggtacccaggatggacagtctttcctgacttcagtaatccagcttgcactgaatggtgg
aaagaccagttcgttgaatttaacagtactctggagtttgatggagtgtggattgaaatg
gatgaagtatccagcttcctccaaagtcctgatcatgagtgtgaactgaacaacttgaac
tttcctcctttcactcctcgtgtcgtggaccgcttgctttttgcaagaaccctctgcatg
gacgctgagtttcacgagggccttcactatgatgtccacagcctgtatggctacttcatg
gcaagagccacagacagggcgatggaggccatcctctccaataaaagaggcttcatcctg
tcccgttctacttttgccggatctggcacatttgctggtcattggctgggggacaacgca
gccacatgggatgatctccgatggtccattcccagtatcctggaattcaacctatttggc
attcccatggtgggcgccaacatctgtggttatacagaaaatgtcacagaggaactctgc
agaaggtggatgcagcttggagcattttatccgctatcgaggaatcacaacgggcctggg
ttcagggaccaggatccggctgcctttagtgaaaacaactcaacgctgttgaattccgcc
agacactatttgaacatccgctacaccctgctgccctatctctacacccttttctaccga
gctcattccttgggggagaccgtagccaggcccctcgtccatgagttctaccaggaccca
gccacgtgggaggtgcacgagcagttcctctgggggcctggactcctcatcacgcctgtt
ttatatgaaggtgtggactctgcaaaagcgtacataccggacgccatctggtacgactat
gagactggagtagccacccaatggaggaaacaatttgtggagatgctactgccaggtgac
aggataggacttcaccttcgagggggctacatctttcccacccagcagccaaacacaacc
acagaggccagtcggaggaattccctgggactcatcattgccttggactataagagagaa
gcaaaggggcagctgtactgggatgacggtgaatctaaagatgctgtagctcaaaacaaa
tacattctgtatgatttttctgtcacctctaaccgtctccaggcaaagattataaaaaat
acgtacacagaccccaacggactcacatttacaaatatcacaatcttgggaatggacaag
gaacctgctaattttactgtcttccttaataatgctgccacccccatttcaaacgttgtc
tacaccagttcgacaaaggtggtgagcatccctgatctccagggactgttactgggacaa
gaattctccattgagtggaatcttccagtgcatgacctgcagaagttcaactgctacccc
gaggagcctgcggtctccgaggagaactgccagcagcgggggtgcctgtgggagcccacg
acggtgcccggcgtgcccacctgtttctacgacaccatccctaattacgccgccagcaac
attcagtacctgcccacgggcatcaccacagacctttcccacctgacagcccctgaatcg
gcagcaccaccgtcttcacggggcgagcaaatccaacccccagtcgccgccgccgccgcc
aaggctgcctcggcctccgatcccctctccgccaagatcagctttctccgagtgagcgtc
atctaccacaccgcaaccatgctgcagttcaagatctatgatcccactaataaaaggtat
gaggtcccagtatctctgaacacacctccctctccagttggctccactgcagaccggctg
tatgatgtcaggattcagaacaatcctttcgggatccagattcgacgaaaaagctctggc
actgtgatttgggactcgcagctccctggtttcaccttcaacgacctgttcctttccatc
tccacgcgcctcccgtctcagtacctctatggctttggggagacagagcacacgacgttc
agaagaaacatgagctggcacatgtggggaatgttcgcccgagatgaaccccccgcgtac
aagaagaattcctacggtgtccacccctactacatggcactggagggggatggcaatgcc
cacggagtcctcctgctgaacagcaacgccatggatgtgaccttccagccgactcctgcc
ctgacataccgcaccacaggaggaattttggacttttatatggttttggggccaaccccc
gagcttgtaactcagcaatacaccgagttgattggtcagccagcaatggttccatactgg
gccttgggattccagctgagtcgatatggataccagaatgatgctgaaatttccaatttg
tatgatgcaatggtggcagctcagattccctacgacgtccagcacgttgacatcgattac
atggaccggaagctggacttcaccctcagccccagctttcagaaccttggcctcctgatt
gagcaaatgaagaaaaatggcatgagatttattctcatcctggatccagccatttctggc
aatgagacccagtatctcacattcaccagagggcaggaaaacaacgtattcatcaaatgg
ccagacaacagtgatattgtctggggaaaggtttggccagacctgcctaatgtgaatgtg
gatgggtcccttgaccctgacactcaggtgaagctgtacagagcccatgtggcttttcct
gacttcttgcggaacagcacggctgcctggtggaagaaggaaatagaagaactctacaga
aaccctcgcgagccagagaagagcttgaagtttgatggattgtggattgacatgaatgaa
ccatcaaactttgtggatggctctgtcacgggctgcagcgatgacgtgctgaataatcca
ccctatatgccgcatttggagtccagggacgggggcctgagcaacaagaccctgtgcatg
gagagccagcagatcctgcccgacggctcccccgtgcggcactacgacgtccacagcctc
tacggctggtcccagaccagacccacctacgaagcggtgcaggaggtgaccggacagcga
ggagtcgtcatcactcgctccaccttcccctcttctggccgctggtcaggacactggctg
ggcgacaacacggcagcgtgggaccagctgaggaaatctatcatcggcatgatggagttc
agtctctttggagtcccttatacaggagcagacatttgtgggttcttcggagatgctgag
tatgagatgtgtgtccgctggatgcagctgggggcgttttatccattttccaggaaccac
aacacatttgggacaaggagacaagatcctgtggcctggaactcaacctttgagatgttc
tcaagaaaagtcctccagaccagatacgccctgctgccttacctctacacgctgatgcac
aaagctcacgttgaaggcagcactgttgtccgaccccttctccatgagtttaccaaggat
gctacaacatgggacatagaccagcagttcatgttgggtcctgccgtcttgatcagccct
gttctggaaagtaacacttttcagatccttgcttattttcccagagcccgttggtatgac
tatagcacggaatctggcagtgaatcgccaggtgagtggaaaatcctggcggctcccctt
gaccatatcaaccttcatatcagaggaggctacatcctgccctggcaggaacctgcgatg
aacaccttctccagtcgacagaaatttatgggattgattgttgctttggatagcagtggg
agagctgacggtcaaatattctgggatgatggacaaagcatcgacacctatgaaaacgga
aactatttcttggcaaactttacagcagctcagaacgtattgcaaattcagaccatacac
aataagtatttgagtgactctaatccactgaaagttggctatattagaatctggggcata
aactctacttatgtaacacaagtcactctcacctatgacaaccagcaatttgtggtgatg
actttcaagagtgacccttataatcagacactaactattcaattgactgacaagattatc
agcctggaaaagttaactgagatttcttggattcatggtggtcctatagtttcaactacg
ccaatgatgagtaccttcccaaagagttcttcatatcctcctacatttactactagagct
accccctctgagactattagtactagttctgctacaacaagcactgctactgctagcagt
attgttactcttcctgtcacaaccacacctttcttaacaaatgctactcaagttccaact
ggtactactgttcctgataacgtgacatcttcccctacaaatgctaccagtgctggcatt
attgtcactcttcctgtcacaatcacatctttcccaacaggtactcctgaagtgccacct
ggtacgactgatcttaataacataacatcttcccctacaaatattaccactgctagtact
gatgttacccttcctgtcacacccacgcctttcccaacaggtactcctgaagtgccacct
ggtacgactgatcttaataacataacatcttcccctaaaaatattaccactgctagtact
gatgttacccttcctttcacacccacacctttcccaacaggtactcctgaagttccaact
ggtccttctattctaaacaccacaacatcttcccctacaaatactaccactcctagcacg
aatgttactcctcctgttacaatcatgcctttcccaacaagtactactgaaatctcaact
ggtactactgttcctgctaacacgacagcttcccctacaaatgctactactgctagcgct
gatgttactcttcctgtcacaaccacacctttcttaacaaatgctactcaagttccaact
ggtactactgttcctgataacgtgacatcttcccctacaaatattaccactgctagtact
gatgttacccttcctttcacacccacacctttcccaacagctactcctgaagttccaact
ggtccttctattctaaacaccacaacatcttcccctacaaatactaccactcctagcacg
aatgttactcctcctgttacaatcatgcctttcccaacaagtactactgaaatctcaact
ggtactactgttcctgctaacacgacagcttcccctacaaatgctactactgctagcgct
gatgttactcttcctgtcacaaccacacctttcttaacaaatgctactcaagttccaact
ggtactactgttcctgataacgtgacatcttcccctacaaatactaccactgctggcact
gttgttacccttcctgtcacaaccacacctttcttaacaaatgctactcaagttccaact
ggtactactgttcctgataacgtgacatcttcccctacaaatactaccactgctggcact
gttgttacccttcctgtcacaaccacacctttcccaacaagtactcctgaagttccaact
ggtacttctattctaaacaccacagtatcttcccctacaaatactaccactcctagcaca
aatgttactcctcctgttacaatcatgcctttcccaacaagtactactgaaatttcaatt
ggtactactgttcctgataacacgacagcttcccctacaaatgctactactgctagcgct
gatgttactcttcctgtcacaaccacacctttcttaacaaatgctactcaagttccaact
ggtactactgttcctgataacgtgacatcttcccctacaaatgctaccagtgctggcatt
attgtcactcttcctgtcacaatcacatctttcccaacaggtactcctgaagtgccacct
ggtacgactgatcttaataacataacatcttcccctacaaatattaccactgctagtact
gatgttacccttcctgtcacacccacacctttcccagcagatacttctgaagtgccaact
ggtccttctattctaaacaccacaacatcttcccctacaaatactaccactcctagcacg
aatgttactctttctgtcacaataatgcttccaacaatactactgaaatttcaactggta
cgactaatcttaataacataa

DBGET integrated database retrieval system