KEGG   Sus scrofa (pig): 100624604
Entry
100624604         CDS       T01009                                 

Gene name
KIF7
Definition
(RefSeq) kinesin-like protein KIF7 isoform X1
  KO
K18806  kinesin family member 7
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04340  Hedgehog signaling pathway
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100624604 (KIF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100624604 (KIF7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100624604 (KIF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100624604 (KIF7)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100624604 (KIF7)
SSDB
Motif
Pfam: Kinesin Microtub_bd VMAP-M4
Other DBs
NCBI-GeneID: 100624604
NCBI-ProteinID: XP_020954619
Ensembl: ENSSSCG00000001840
LinkDB
Position
7
AA seq 1356 aa
MGLEAQRLPAAEKAPVRVALRVRPLLPKELLHGHQSCLRVEPGHGGVTLGRDRHFGFHVV
LDEDAGQETVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGETSVASLHEDEQGII
PRAMAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDDRGNVVVCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHLNRLSSRSHTVFTVTLEQRGRAPSRLPRPPA
GQLLISKFHFVDLAGSERVLKTGSTGERLKESIQINSSLLALGNVISALGDPQRRSSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNICNRATINWQLE
AERAPEEAAAAVLARGPPKHRSETRIIHRGRRAPGPAAASAAATARLGAECARYRARTDA
AYSLLRELQAEPGLPGAAARKVRDWLCAVEGERSALSSASGPDSGIESASAEEQATQGPG
GQKEDEGGLQLLALQSQVAQLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMAELRLRL
ELVRPGWGAPGLLQGLPPGSFVPRPHTAPLGGANTHVLGMVPPGCLPGDGAGPENWGEMT
DARESGTRFLEVGDRLGSGSSAASSEEEEEEEEGGGAGEELEPLRRTLHLRRNGIGKRSQ
RMGACSGNPLGRKDPELRLGELGTAILGPRVVGGSKTPAWPPQAPAATASEWRLAQAQQK
IRELAINIRMKEELIGELVRTGKAAQALNRQHSQRIRELEQEAERVRAELSEGQRQLREL
ESKEPQDAGSRSQLQEFRKRVAAAQSQVQVLKEKKQVTERLVSLSAQSEKRLQELERNVQ
LMRQQQGQLQRRLREETEQKRRLETEMNKRQHRVKELELKHEQQQKILKIKTEEIAAFQR
KRRSGSNGSVVSLEQQQKIEEQKKWLDQEMEKVLQQRRALEELGEELRKREAILAKKEAL
MQEKTGLESKRLRSSQALSEDIVRVSSRLEHLEKELTEKSEQLRQGSAQSQQQIRREIDA
LRQEKDSLLKQRLEIDGKLRQGNVLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRV
LRASASLLSQCEMNLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLE
EQQRLVYWLEVALERQRLEMDRQLTLQQKEHEQNMQLLLQQSRDHLGEGFADSKRQYETR
IQALEKELGRHVWLNQELKQQLSSLDTGGQGRVTGGEKRTLCLDNRQAPANEDGPHAAPE
PLWQSPLVEGAPRAREEIRDLVHAPLPLTWKRSSLCSEEQGSPEELRQREATEPLVGRVL
AVGEVGPPWNLGSLPKPRRELRRASPGMIDVRKNPL
NT seq 4071 nt   +upstreamnt  +downstreamnt
atggggctggaggcccagaggctgccagcggccgagaaggccccagtgagggtggccctt
cgagtccgcccgctgcttcccaaggagctgctgcatgggcaccagagctgcctgagggtg
gagccggggcatggcggagtcaccctgggccgagaccgccactttggcttccatgtagtg
ctggacgaggatgccgggcaggagactgtataccaggcctgtgtgcagcccctcctggag
gctttctttgagggcttcaatgccaccgtctttgcctacggtcagacaggctctgggaag
acgtacaccatgggagagaccagtgtcgcctcccttcatgaggatgaacagggcatcatc
ccgcgggccatggctgaggccttcaagctgattgatgagaacgacctgcttgactgtctg
gtgcacgtgtcctacctggaagtgtacaaggaggagttccgggacctgctggaggtgggc
actgccagccgtgacatccagcttcgggaggatgatcgcgggaatgttgttgtgtgtggg
gtgaaagaggtggacgtggagggcctggacgaggtgctgagcctcctggagatgggcaac
gcagcgaggcacacgggggccacacacctcaaccgcctctccagccgctcacacactgtc
ttcaccgtgactctggagcagaggggccgggcgccgagccgcctgcctcgaccccccgcg
ggccagctgctcatctccaagttccacttcgtggacctggcaggctcggagagggtactc
aagacaggcagcacgggtgagcggctcaaggagagcatccagatcaacagcagcctcttg
gcgctgggcaacgtcatcagcgccctgggcgacccccagcgccgcagcagccacatcccc
taccgggactccaagatcacccggatcctcaaagactccctgggcgggaacgccaagaca
gtgatgatcgcctgtgtcagcccgtcctcctccgactttgacgagaccctcaacaccctc
aactacgccagccgtgcccagaacatctgtaaccgcgccaccatcaactggcagctcgag
gccgagcgggctcccgaggaggcggcggcggcagtcctggcgcgagggcctccgaagcac
cgctcggagacgcgcatcatccaccggggccggcgcgccccgggccctgcggccgcctcc
gctgcggccaccgcccgcctgggcgccgagtgtgcgcgctaccgagcccgcaccgacgcc
gcctacagcctcctgcgtgagctgcaggccgagcctggcctgcctggtgctgccgcccgc
aaggtgcgcgactggctgtgcgccgtcgagggcgagcgcagcgccctgagctccgcctct
gggccggacagcggcatcgagagcgcctccgccgaggagcaggccacgcaggggcctggc
gggcaaaaggaagatgagggggggctgcagctgctggccctgcagagccaggtggcccag
ctggaggaagagaaccgggactttctggctgcgctggaggacgccatggagcagtacaaa
ctgcagagcgaccgtcttcgtgagcagcaggaggagatggcagagctgcggctgcggctg
gagctagtgcggcctggctggggggccccagggctcttgcagggcttgccccctgggtcc
tttgtgcctcgtcctcacacagctcccctggggggtgccaacacccatgtgctgggcatg
gtgccccctggctgccttcctggagacggagctggtcctgagaactggggagagatgaca
gatgccagggagtctggcaccaggtttctggaggtgggagacaggctgggaagtggctct
tcagctgcatcatcagaggaagaggaggaggaggaagaggggggaggggcgggggaagag
ttggagcccctccggcggaccctgcacctgcgcagaaacgggatcggtaagcggagccag
aggatgggggcctgctcagggaatccacttggcaggaaggacccagagcttcgcctgggg
gagctgggcacagccatcctggggcccagagtggttggtgggagcaagaccccagcttgg
cccccccaggctccggctgccaccgcctctgagtggcggctggcccaagcacagcagaag
atccgcgagctggccatcaacatccgcatgaaggaggagctcatcggcgagctggtccgc
acagggaaggcggcccaggccttgaaccgccaacacagccaacgcatccgagagctggag
caggaggccgagcgggtgcgggccgagttgagcgaaggccagaggcagctgcgggagctt
gagagcaaggagccccaggacgctggctcacgttcccagctccaggaattccgcaagagg
gttgctgccgctcaaagccaggtgcaggtgctgaaggagaagaagcaggtgacagagcgg
ctggtgtcgctgtcggcccagagtgagaagcggctgcaggagcttgagaggaatgtgcaa
cttatgcggcagcagcaggggcagctgcagaggcggcttcgagaggagacggagcagaag
cggcgcctggagacagagatgaacaagcggcagcaccgagtcaaggagctggagctaaag
cacgagcagcagcaaaagatcctgaagatcaagacagaagagatcgcggcgtttcagagg
aagcggcgcagtggcagcaatggctctgtggtcagcctggagcagcaacagaagatcgag
gagcagaagaagtggctggaccaggagatggagaaggtgcttcagcagcggcgggcactg
gaggagctgggggaggagctccgcaagcgggaagccatcctggccaagaaggaggccctg
atgcaggagaagacagggctggagagcaagcggctgcggtccagccaggccctcagcgag
gacattgtgcgagtgtccagccggctggagcacctggagaaggagctcacggagaagagc
gagcagctgcggcagggcagcgcccagagccagcagcagatccgcagggagattgacgct
ctgcgccaggagaaggactcactgctcaagcagcggctggagatcgatggcaagctgagg
cagggcaacgtgttgtcccctgaggaggagcggacactgttccagctggatgaggccatt
gaggccctggatgcggccatcgagtacaagaacgaagccatcacgtgccgtcagcgggtg
ctgcgggcctcagcctccttgctgtcccagtgcgagatgaacctcatggccaagcttagc
tacctctcgtcctcggagactagagccctgctctgcaagtactttgacaaggtggtgacg
ctccgagaggagcagcaccagcagcagattgccttctcggagttggagatgcagttggag
gagcagcagaggctggtctactggctggaggtagccctggagcggcagcgcctggagatg
gaccgccagctgaccctgcagcagaaggagcatgagcagaacatgcagctcctgctccag
cagagtcgagaccaccttggtgaagggtttgcggacagcaagaggcagtatgagaccagg
atccaagctctggagaaggagctgggccgccacgtgtggctaaaccaggaactgaagcag
cagctcagcagtttggacactggaggccagggcagggtgacaggtggggagaagaggacc
ctgtgcctggacaacagacaagcccctgcaaatgaagacgggccccacgcagcacctgag
ccgctctggcagtcccccctcgtcgagggcgcccccagggcccgggaggagataagggac
ttggtccatgccccattgccgttgacatggaaacgctcgagcctgtgcagtgaggagcag
ggctcccctgaggagctgcggcagcgggaggccactgagcccctggtggggcgggtgcta
gctgtgggtgaggtgggtccaccctggaacctcgggtccttgcccaagccccggcgggaa
ctacgaagggccagcccagggatgattgacgtcaggaagaaccccctgtag

DBGET integrated database retrieval system