KEGG   Sus scrofa (pig): 100624718Help
Entry
100624718         CDS       T01009                                 

Gene name
NUDT1
Definition
(RefSeq) 7,8-dihydro-8-oxoguanine triphosphatase
  KO
K17816  8-oxo-dGTP diphosphatase / 2-hydroxy-dATP diphosphatase [EC:3.6.1.55 3.6.1.56]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100624718 (NUDT1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     100624718 (NUDT1)
    3.6.1.56  2-hydroxy-dATP diphosphatase
     100624718 (NUDT1)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100624718 (NUDT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 100624718
NCBI-ProteinID: NP_001231497
UniProt: A0A287AR30
LinkDB All DBs
Position
3
AA seq 156 aa AA seqDB search
MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDAAKRELQEESGLT
VDVLHKVGQIVFEFAGDPELMDVHIFRTDSVQGTPEESDEMRPQWFQLDQIPFGDMWPDD
RYWFPLLLQKKKFRGYFKFQGHDTIVDHTLREVDAV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctcgaggctctacaccttggtcctggtgctgcagcctcagcgagtcctcctg
ggcatgaagaaacgaggcttcggggccggccgctggaacggcttcgggggcaaagttcaa
gaaggagagaccatcgaggacgcggccaagagggagctgcaggaagagagcggcctgacg
gtggacgtgctacacaaggtgggccagatcgtgttcgagttcgcaggtgaccccgagctg
atggacgtgcacatcttccgcacagacagcgtccaggggacgcctgaggagagcgacgaa
atgcgcccccagtggttccagctggaccagatccctttcggtgacatgtggcctgatgac
cgttactggttccccctcctgcttcagaagaagaagttccgtggctacttcaagttccaa
ggccacgacaccatcgtggaccacacgctccgcgaggtggacgcggtctag

DBGET integrated database retrieval system