KEGG   Sus scrofa (pig): 100625290
Entry
100625290         CDS       T01009                                 

Gene name
ZBTB16
Definition
(RefSeq) zinc finger and BTB domain-containing protein 16
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100625290 (ZBTB16)
   05202 Transcriptional misregulation in cancer
    100625290 (ZBTB16)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100625290 (ZBTB16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100625290 (ZBTB16)
   04121 Ubiquitin system [BR:ssc04121]
    100625290 (ZBTB16)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    100625290 (ZBTB16)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100625290 (ZBTB16)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 BTB zf-met zf-C2H2_6 zf-C2H2_jaz zf_UBZ zf-C2H2_2 Endonuclease_7 MIX
Other DBs
NCBI-GeneID: 100625290
NCBI-ProteinID: XP_020918527
Ensembl: ENSSSCG00000030095
LinkDB
Position
9
AA seq 673 aa
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAAQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGALQPPAGPEEPTLAGGGRHPAVAE
VKPEMMQVDEVPSQDSPGAAESSISAGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQLPPPTEAGQGPPGRPEPPAPPAEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
TLAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRSVGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggatctgacaaagatgggcatgatccagctgcagaaccccagccaccccacggggctc
ctgtgcaaggccaaccagatgcggctggccgggacgctgtgcgatgtggtcatcatggtg
gacagccaggagttccatgcccaccggaccgtgctggcctgcaccagcaagatgtttgag
atcctcttccaccgcaacagccagcactatactctggacttcctctctccaaagaccttc
cagcagattctggagtatgcatacacggccacgctgcaagccaaggcggaagacctggat
gacctgctgtatgcggctgagatcctggagattgagtacctggaggagcagtgcctgaag
atcctggagaccatccaagcctcagacgacaatgacacggaggccaccatggcggatggc
ggggccgaggaagaagaggaccgcaaggctcggtatctcaagaacatcttcatctcgaaa
cattccagcgaggagagtgggtatgccagtgtggctgcccagagcctccctgggcccatg
gtggaccagagcccttctgtctccacctcgtttggtctttcagccatgagtcccaccaag
gcggcggtggacagtttgatgaccatagggcagtctctcctgcagggggctcttcagcct
cctgccgggcctgaggagccgactctggcggggggaggtcggcaccctgcggtggccgag
gtgaagccggagatgatgcaggtggatgaggtgcccagccaggacagccctggggcagcg
gagtctagcatctcggctgggatgggggacaaggttgaggaaagggggaaggaggggccc
ggaaccccaactcggagcagcgtcatcaccagcgctcgggagctacactatggacgcgag
gagagtgctgagcagctgccccctcccaccgaggctggccagggccccccaggccgacca
gagccccccgcgcccccagccgagaagcacctgggcatctactccgtgttgcccaaccac
aaggccgatgccgtgttgagcatgccgtcctcggtgacctcgggcctccacgtgcagccc
accctggctgtctccatggactttagcacctacgggggtctgctgccccagggcttcatc
cagagggagctattcagcaagctgggggagctggccgtgggcatgaagtcggagagtcgc
agcgtcggggagcagtgcagcgtgtgcggggtggagcttcctgacaacgaggcagtggag
cagcacaggaagctgcacagtgggatgaagacgtacgggtgtgagctctgcggaaagcgg
ttcctggatagtttgcgactgagaatgcacttactggctcattcagcgggtgccaaagcc
tttgtctgtgatcagtgcggtgcccagttttcgaaggaggatgccctggagacacacagg
cagacccataccggcacggacatggctgtcttctgtctgctgtgcgggaagcgtttccag
gcccagagcgcgctccagcagcacatggaagtccacgcgggcgtacgcagctacatctgc
agcgagtgcaaccgcaccttccccagccacaccgccctcaaacgccacctgcgctcacat
acaggtgaccacccgtatgagtgtgagttctgtggcagctgcttccgggatgagagcaca
ctcaagagccacaagcgcatccacacgggcgagaaaccctacgagtgcaatggctgtggc
aagaagttcagcctcaagcaccagctggagacgcactatcgagtgcatacaggagagaag
cccttcgagtgtaagctgtgccaccagcgctcccgggactactcggccatgatcaagcac
ctgcggacccacaacggcgcctcgccctaccagtgcaccatctgcacggagtactgcccc
agcctgtcctccatgcagaagcacatgaagggccacaagcccgaggagatcccgcccgac
tggaggatagagaagacgtacctctacctgtgttacgtgtga

KEGG   Sus scrofa (pig): 396709
Entry
396709            CDS       T01009                                 

Gene name
RARA
Definition
(RefSeq) retinoic acid receptor alpha isoform X2
  KO
K08527  retinoic acid receptor alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04659  Th17 cell differentiation
ssc04915  Estrogen signaling pathway
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    396709 (RARA)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    396709 (RARA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396709 (RARA)
   05202 Transcriptional misregulation in cancer
    396709 (RARA)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    396709 (RARA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    396709 (RARA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ssc03310]
    396709 (RARA)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    396709 (RARA)
Nuclear receptors [BR:ssc03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   396709 (RARA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 396709
NCBI-ProteinID: XP_003131521
Ensembl: ENSSSCG00000017475
UniProt: A0A287BAX0 A0A4X1UBA7
LinkDB
Position
12
AA seq 459 aa
MYESVDVGGLTPTPSPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIET
QSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYT
CHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEAPKPECSESYTLTPE
VGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFA
KQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFG
PLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYV
RKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTL
SGQAGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgtacgagagtgtggacgtgggggggctcacccccacccccagtcccttcctggtggtg
gatttttataaccagaaccgggcctgtttgctcccggagaaggggctccccgcccccggc
ccctactccaccccgctccggactccgctttggaatggctcaaaccactccattgagacc
cagagcagcagttccgaagagatagtgcccagccctccctcgccgccccccctcccccgc
atctacaagccttgctttgtctgtcaagacaaatcctcaggctaccactatggggtcagc
gcctgtgagggctgcaagggcttcttccgccgaagcatccagaagaacatggtgtacacg
tgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgccagtactgc
cggctgcagaagtgctttgaagtgggcatgtccaaggagtccgtgaggaacgaccggaac
aagaagaagaaggaggcgcccaagcccgagtgctccgagagctacacgctgacgccggag
gtgggggagctcatcgagaaggtgcgcaaagcgcatcaggagaccttccccgccctctgc
cagctgggcaaatacactacgaacaacagctccgagcagcgcgtctctctggacattgac
ctctgggacaagttcagtgaactctccaccaagtgcatcattaagacggtggagttcgcc
aagcagctgcccggcttcaccaccctcaccatcgccgaccagatcaccctcctcaaggct
gcctgcctggacatcctgatcctgcggatctgcacgcggtacacgcctgagcaggacaca
atgaccttctcagacggactgaccttgaaccggacccagatgcacaacgccggctttggg
cctctcacggacctggtcttcgccttcgccaaccagctgctgcccctggagatggatgat
gctgagactgggctgctcagtgccatctgcctcatctgtggagaccggcaggacctggag
cagccagacagggtggacatgctgcaggagccactgcttgaggcactgaaggtctatgtg
cggaaacggaggcccagccgcccacacatgttccccaagatgctgatgaagatcacagac
ctgcgaagcatcagtgctaagggggccgagcgggtgatcacgctgaagatggagatcccg
ggctccatgccacctctcatccaggaaatgctggagaactcagagggcctggacactctg
agcggacaagcggggggcggggggcgggacgggggcggcctggccccgccgcctggcagc
tgcagccccagcctcagccccagctcgaacagaagcagcccggccacccactccccgtga

DBGET integrated database retrieval system