KEGG   Sus scrofa (pig): 100626194
Entry
100626194         CDS       T01009                                 

Gene name
NKD1
Definition
(RefSeq) protein naked cuticle homolog 1 isoform X1
  KO
K03213  naked cuticle
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100626194 (NKD1)
   04390 Hippo signaling pathway
    100626194 (NKD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ssc04990]
    100626194 (NKD1)
Domain-containing proteins not elsewhere classified [BR:ssc04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100626194 (NKD1)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_1
Other DBs
NCBI-GeneID: 100626194
NCBI-ProteinID: XP_020949855
LinkDB
Position
6
AA seq 482 aa
MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGSSGPRQLRAVGTVG
RGTRELVGEVFRETLSEEEEEDFRLEVALPPEKTDGLASGDEKRMEKVGDSCPGSKKQLK
FDELQCDVSVEEDSRQEWTFTLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKT
LRVKLTVAPDGSQSKKSILLNHPGEGLEHHPARGDLQSTRPRAETKPAEELRSWEKKQRA
LLRFQGDSRLEQSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVAQKSELPPRA
SNPTRSRSHEPEAAHITHRKPPGADPSSFHFLDAPFAKVSEVQQRLRGGTQDGSKHFVRS
PKAQGKSVSVGHGARGARSKPPVGPAVPAVPASGHLAASPALLPTLAPLGHKKHKHRAKE
SQPGCRGVQAPLAVGGPVVGRDHVRELPAVVVYESPAGQAVQRHEHHHHHEHHHHYHHFY
QT
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggggaaacttcactccaagccggccgccgtgtgcaagcgcagggagagcccggaaggt
gacagcttcgcagtgagcgccgcctgggctcggaaaggcatcgaagagtggatcgggagg
cagcgctgcccgggtggcagctccggaccccgacagctgcgggcggtgggcaccgttggc
agaggaacccgggagcttgtgggcgaagttttcagagaaacgctcagcgaggaggaagag
gaggacttccggctagaagtggccctgcctcccgagaagacggacgggctggccagtggc
gatgagaagaggatggagaaggtcggggactcttgccccggctccaagaagcagctgaaa
tttgatgagctgcagtgtgacgtgtcggtggaggaggacagccggcaggagtggaccttc
accctgtatgactttgacaacaacggcaaggtcacccgtgaggacatcaccagcctgctg
cacaccatctatgaggtggtggattcctctgtcaaccactccccgacgtccagcaagacg
ctgcgggtaaagctcaccgtggcccccgacgggagccagagcaagaagagcatccttctc
aatcaccctggggaagggctggagcaccatcctgcccgcggggacctgcagagcaccagg
cccagagcagagaccaagcccgcggaggaactgcgaagctgggagaagaagcaacgggct
ctcctcaggttccagggtgacagccgtctggagcagtctggctgctaccaccattgcgta
gatgagaacattgagaggagaaaccactacttagacctcgccggcatagaaaactacaca
tcccagtttgggcctggctccccgtcagtggcccagaagtcagaactgcccccccgcgcc
tccaaccccactcgatctcgctcccacgagcccgaagctgcccacatcacgcaccggaag
cccccaggcgcggaccccagctccttccactttctcgatgcccccttcgccaaggtctcc
gaggtccagcagcggctccggggtggcacccaggacgggagcaagcactttgtgaggtcc
cccaaggcccagggcaagagcgtgagtgtgggccacggggccagaggggccagaagcaaa
cccccagtgggacccgccgtccctgcagtgcccgcctccggccacctggccgccagtccc
gccctcctccccacgctggcgcccctcgggcacaagaagcacaagcaccgcgccaaggag
agccagccggggtgccggggcgtgcaggcgcccctggccgtgggcggccccgttgtgggg
cgggaccacgtgcgggagctgcccgccgtggtggtgtacgagagcccggcgggccaggcg
gtccagagacacgagcatcaccaccaccacgaacaccaccaccattaccaccacttttac
cagacatag

KEGG   Sus scrofa (pig): 110257348
Entry
110257348         CDS       T01009                                 

Gene name
NKD2
Definition
(RefSeq) LOW QUALITY PROTEIN: protein naked cuticle homolog 2
  KO
K03213  naked cuticle
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110257348 (NKD2)
   04390 Hippo signaling pathway
    110257348 (NKD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ssc04990]
    110257348 (NKD2)
Domain-containing proteins not elsewhere classified [BR:ssc04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   110257348 (NKD2)
SSDB
Other DBs
NCBI-GeneID: 110257348
NCBI-ProteinID: XP_020932798
LinkDB
Position
16
AA seq 454 aa
MGKFQSKHASAAFKRRESPEGDSFVVSAYTSGRKGMEEAERRGGGVEHSAWDKQELPGGD
LKEGPFWEDQCALEVALPPERAEGREGPGQLFGTDGGERAANREGPRWLGKKRLNVDALQ
CDVSVEEDNHQEWTFTLYGFDNSGKATREDMSSLMHTIYEVVDASVSHSSGGSKTLRVKL
TVSPEPAGKRREGPPAVQDREPIRCRTEGELAEDPRVADKRLYLHIRRPHPDAHLYSERG
SYCVDENTERRNHYLDLAGIENYTSRFGPGSPPAQARQEHQARAPHPQGRSRSQESDAHA
THHRRCQLPPEHALLAVEPVPRALDLQPRPKGQEKQFLRSPQGSGRPPGGGRPGRSFSYX
PAAPDPAGPQDGPHLPQPPPPPYGHRRCRQRGREGHSPLKAALGQPPVLEHEVVRDLPPV
LLGEALAVPVVQRHEHHHHHEHHHHHHHHHHPPA
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggggaaattccagtccaagcacgcctctgcagccttcaagcggagagagagccccgaa
ggggacagcttcgtggtgtctgcgtacacgagtggccgcaaaggcatggaggaggcagaa
cgtcggggcggcggcgtggagcacagtgcgtgggacaagcaggagctgcctggcggcgac
ctcaaggaagggcctttctgggaagaccagtgcgccctggaggtggcactgccgcctgag
agggctgagggccgggagggcccaggacagctcttcggtacagacggtggagaaagagcc
gcaaaccgcgagggcccccggtggctgggcaagaagcgcctcaacgtggacgcgctccag
tgcgacgtctcggtggaggaggacaaccaccaggagtggacgttcacgctctacggcttc
gacaacagtggcaaagccaccagagaggacatgtcgagcctgatgcacaccatctacgag
gtggtggacgcctccgtcagccactcctctggcggcagcaagaccctccgcgtgaagctg
accgtcagcccggagcccgccggcaagaggagggaagggccccccgccgtccaggaccgg
gagcccatccgctgcaggacggagggggagctcgccgaggaccccagggtggccgacaag
aggctgtacctgcacatcaggaggccccaccccgacgcccacctctactctgagcggggg
tcctactgtgtggacgagaacacggagcggaggaaccactacctggacctggccgggatc
gagaactacacgtccagattcgggccggggtcccctccggcgcaggccaggcaggagcac
caggccagggccccgcacccccagggcaggtcgcgctcccaggagtcagatgcgcatgcc
acgcaccaccgccggtgccagctgccgccagagcacgccctgctggctgtcgagcccgtc
ccccgggcgctggacctgcagccccggccgaaggggcaggagaagcagttcctgaggtcc
ccccagggctcggggaggccgccaggcgggggcaggcccgggaggtccttcagctacnca
cccgccgcccccgaccccgcaggcccccaggacggcccccacctcccgcagcccccgccc
ccgccctacggccaccggcgctgccggcagaggggcagggagggccactcgccgctcaag
gccgcgctgggccagcccccagtgctggagcacgaggtggtgcgggacctgccgcccgtg
ctgctgggcgaggccctggcggtgcccgtggtccagcgccacgagcaccaccaccaccac
gagcaccaccaccaccaccaccaccaccaccaccccccggcctag

DBGET integrated database retrieval system