KEGG   Sus scrofa (pig): 100626791Help
Entry
100626791         CDS       T01009                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00350  Tyrosine metabolism
ssc01100  Metabolic pathways
Module
ssc_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100626791 (GSTZ1)
Enzymes [BR:ssc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100626791 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 100626791
NCBI-ProteinID: NP_001230567
Ensembl: ENSSSCG00000002396
Vega: OTTSUSG00000003638
UniProt: F1S2N0
LinkDB All DBs
Position
7
AA seq 216 aa AA seqDB search
MQAGKPILYSYFRSSCSWRVRIALALKNIDYEIVAINLIKDGGQQFSKEFQALNPMKQVP
ALKIDGITLSQSLAIIEYLEETRPTPRLLPQDPKKRAQVRMISDLLASGIQPLQNLSVLN
QVGKENQLTWAQRVIAPGFNALEQILQSTAGKYCMGDEVSMADLCLVPQVANAERYKVDL
SPYPTISRINKSLLALEAFQVSHPSRQPDTPPELRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggggaagcccatcctctattcctatttccgaagctcctgctcgtggagagtg
cgaattgctctggccttgaaaaacatcgactatgagatagtagccatcaaccttataaag
gatggggggcagcagttctccaaagaattccaggccctgaatcccatgaagcaggtgccg
gccctgaagattgatggaatcaccctcagccagtcactggccatcattgagtacctggag
gagacccggcccacgccccgacttctgcctcaggacccaaagaagagggcccaagtgcgc
atgatttctgacctcctcgccagtggcatccaacccctgcagaacctgtctgtcctgaat
caagtgggaaaggagaaccagctgacctgggcccagcgggtcatcgctcctggctttaac
gctctggagcagatcctgcagagcacagcggggaagtactgcatgggagatgaggtgtcc
atggctgacctgtgcttagtgcctcaggtggcaaatgctgaaaggtacaaggtggatctc
tctccctaccccaccatcagccgcatcaacaagtccctgctggccttggaggccttccaa
gtgtctcaccccagccggcagccagatacaccccccgagctgagggcctag

DBGET integrated database retrieval system