KEGG   Sus scrofa (pig): 100627123
Entry
100627123         CDS       T01009                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha precursor
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04144  Endocytosis
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04540  Gap junction
ssc04630  JAK-STAT signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc05163  Human cytomegalovirus infection
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100627123 (PDGFRA)
   04014 Ras signaling pathway
    100627123 (PDGFRA)
   04015 Rap1 signaling pathway
    100627123 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100627123 (PDGFRA)
   04020 Calcium signaling pathway
    100627123 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100627123 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100627123 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100627123 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100627123 (PDGFRA)
   04540 Gap junction
    100627123 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100627123 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100627123 (PDGFRA)
   05206 MicroRNAs in cancer
    100627123 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100627123 (PDGFRA)
   05231 Choline metabolism in cancer
    100627123 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100627123 (PDGFRA)
   05218 Melanoma
    100627123 (PDGFRA)
   05215 Prostate cancer
    100627123 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100627123 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100627123 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100627123 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ssc04090]
    100627123 (PDGFRA)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100627123 (PDGFRA)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100627123 (PDGFRA)
CD molecules [BR:ssc04090]
 Proteins
  100627123 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 100627123
NCBI-ProteinID: NP_001302685
Ensembl: ENSSSCG00000028873
UniProt: A0A4X1UD13 A0A0G2YI07
LinkDB
Position
8
AA seq 1089 aa
MGTSHRMLLVLGCLFTGPSLILCQLSLPSILPNENEKVVQLNASFSLRCFGESEVSWQYP
MSEEENPSVEIRSEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQREESEIEGRAIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLSSDGVVHASYDSRQGFNG
TFTVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKAGESIVVTCAVFNN
EVVDLQWTYPGQVKGKGITMLEETKVPSIKLVYTLMVPEATVKDSGDYECAARQATREVK
EMKKVTISVHERGFIEIKPNFSPLEAVNLHEVRHFVVDVQAYPPPRIAWLKDNLTLTENL
TEITTDIERIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGEQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRD
RSTVEGQVTFAKVEETVAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSDGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatcggatgctgctggtcttaggctgtctctttacagggccgagcctc
atcctctgccagctttcactaccctccatcctgccaaacgaaaatgagaaggttgtgcag
ctgaatgcatccttttctctgagatgctttggggagagtgaggtgagctggcagtacccc
atgtctgaagaagagaaccccagcgtggagatcagaagtgaggagaacaacagtggcctt
tttgtgacagtgctggaagtggtcagtgcctcggcggcccacacagggctgtacacttgc
tattacaaccacacgcagagagaagaaagtgagattgagggcagggccatctacatctat
gtgccagacccggatgtagccttcgtgcctctaggaatgacagattatctggtcatcgtg
gaggacgatgactctgccatcatcccgtgtcgcacgactgatcctgagaccccggtgacc
ttgctcagcagcgatggggtggtgcacgcctcctatgacagcagacagggctttaatgga
accttcaccgtcgggccctatatctgcgaggccaccgtcagagggaagaagttccagacc
atccccttcaacgtctatgctttaaaagcaacatcagaacttgatctggaaatggaagct
cttaaaactgtatacaaggctggagaatccatcgtggtcacctgtgccgtctttaacaac
gaggtggttgacctccagtggacttatcctggacaagtgaaaggcaaaggcatcaccatg
ctggaggaaaccaaggtcccgtccatcaaattggtgtacacgctgatggtccccgaggcc
acggtcaaagacagtggagattacgaatgtgctgcccgccaggccaccagggaggtcaaa
gaaatgaagaaagtcaccatttctgtccacgagagagggtttattgaaatcaaacccaac
ttcagccctttggaagctgtcaatctgcatgaagtcagacattttgtggtggacgtgcag
gcctacccgcctcccaggatagcctggctgaaggacaacttgacactgaccgagaatctc
acggagatcaccactgacatcgaaaggattcaggaaataaggtatcgaagcaaattaaag
ctgatccgagctaaggaagaagacagtggccattatactattgtagttcagaatgaagat
gatgtcaagagctatacttttgaactcttaacccaagttccatcctctattctggacttg
gtcgacgaccaccacggctctaatggggaacagactgtgaggtgcacggctgaagggacc
cctcttcctgatatcgagtggatgatttgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaataacgtttcaaatatcatcacggagatccacccccgagac
agaagcacggtggagggccaggtgacattcgccaaagtggaggagaccgttgcagtccga
tgcttggctaagaacctccttggggttgagagccgagagctgaagctggtggctcccact
ctgcgttccgaacttacggtggcggcagccgtcctggtgttgctggtgattgtgatcatc
tcccttattgtcctggttgtcatttggaaacagaaacccaggtatgaaattcgttggaga
gtcattgagtcaatcagccccgatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcgaggtgggagtttccaagagatggactagtgcttggtcggatcctgggg
tctggtgcgtttgggaaagtggttgaaggaactgcctatggattaagccggtcccaacct
gtcatgaaagtagctgtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccatctggggccacatttaaacattgtgaacctg
ctgggagcctgtaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcacaagaatagagacagcttcctgagccgccacccagagaag
ccaaagaaggagctggacatttttggactgaaccccgctgatgagagcacacggagttat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaagctgacaccacc
cagtatgtccccatgttggaaaggaaagaagtttctaaatactcagacatccagagatca
ctgtatgatcgcccagcctcatataagaagaaatccatgctagactctgaagtcaaaaac
ctcctttcggacgataactctgatggccttactttgttggatctgttgagttttacctat
caagttgcccgaggaatggagtttctggcttcaaaaaattgtgtccaccgagacctggct
gctcggaacgtcctcctggcacaagggaagattgtgaagatctgtgactttggcctggcc
agggacatcatgcatgactcgaattacgtgtcaaaaggcagtactttcctcccggtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagcgacgtctggtct
tacggcattctgctctgggagatcttttcccttggtggcacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gctaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgagatcgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggacttcctgaagagtgaccatcccgccgtggcacgcatg
cgcgtggactctgacaacgcctacatcggcgtcacctacaaaaacgaagaggacaagctg
aaggactgggagggtggcctggacgagcagaggctgagcgccgacagcggctacatcatc
cctctgcccgacatcgaccccgttcctgaggaggaagacttgggcaagaggaacagacac
agctctcagacctctgaagagagtgccattgagacgggctccagcagttctaccttcatc
aagagagaggatgagaccattgaggacattgacatgatggacgacattggcatagactcc
tcggacctggtggaggacagcttcctgtga

DBGET integrated database retrieval system