KEGG   Sus scrofa (pig): 100627508
Entry
100627508         CDS       T01009                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc03013  RNA transport
ssc04012  ErbB signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04211  Longevity regulating pathway
ssc04218  Cellular senescence
ssc04910  Insulin signaling pathway
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05221  Acute myeloid leukemia
ssc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100627508 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100627508 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    100627508 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    100627508 (EIF4EBP1)
   04152 AMPK signaling pathway
    100627508 (EIF4EBP1)
   04150 mTOR signaling pathway
    100627508 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100627508 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100627508 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    100627508 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100627508 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100627508 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100627508 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    100627508 (EIF4EBP1)
   05165 Human papillomavirus infection
    100627508 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100627508 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ssc03019]
    100627508 (EIF4EBP1)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100627508 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 100627508
NCBI-ProteinID: NP_001231154
Ensembl: ENSSSCG00000022301
UniProt: A0A4X1VV86
LinkDB
Position
15
AA seq 120 aa
MSSGSSCSQTPSRAIPTTRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPVGDEPPTDASQNHLRSSPDDKPAGAGGEESQFEMDI
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtccagcggcagcagctgcagccagaccccaagccgggcaatccccaccactcgccgg
gtggtcctcggcgatggcgtgcagctgccgcccggggactacagcaccactcccggcggc
acgctcttcagcaccaccccaggaggtaccaggatcatctatgaccggaagttcctaatg
gagtgtcggaactcacctgtgaccaaaacgcccccgagggacctgcccaccattcccggg
gtcaccagccctgtgggtgatgagccccccacagatgccagccagaaccacctgcgcagt
agcccagacgacaagccggcgggggcgggcggtgaagagtcacagtttgagatggacatt
taa

DBGET integrated database retrieval system