KEGG   Sus scrofa (pig): 100627559Help
Entry
100627559         CDS       T01009                                 

Gene name
HDAC7
Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05034  Alcoholism
ssc05165  Human papillomavirus infection
ssc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    100627559 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    100627559 (HDAC7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    100627559 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100627559 (HDAC7)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100627559 (HDAC7)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100627559 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100627559
NCBI-ProteinID: XP_020948263
LinkDB All DBs
Position
5
AA seq 981 aa AA seqDB search
MHNPGADGTQVSPGAHGPSLPGTGCPRPRTDTPGPQPQPMDLRVGQRPLVEPPPEPSLLA
LQHTQRLPHHLFLGAVQPQRSVEPMRLSMDTMPELQVGQQEQELRQLLNKDKSKRSAVAS
SVVKQKLAEVILKKQQAALEKTVHPNSPSVPYRTLEPLETEGAARSMLSSFLPPVPSLPS
DPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSS
STPASGCSSPNDSEHGPNPVLGSEALLGQRLRLQETSLAPFALLPTITLGLPAPARADGD
RRTHPTLGPRGPVLGXPHAPLFLPHGLEPEAGGPLPSRLQPILLLDPSVSHAPLLTVPGL
GPLPFHFAQSLMTSERLSGSGLHRPLSRTRSEPLPPSAPLGALQPRLERLKPHVQLIKRP
AKPSEKPRLRQIPSAEDLETDAGGLGPVGEDGLEHRESSHGQHEARGPVPLQQHQQVFLW
EQQRLAGRLPRGGAGDPVLLPLAQGGHRPLSRAQSSPAAPASLPTPEPPSQARVLPSSET
PTRTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLLERGLRSQCESLRGRK
ASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNE
LHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQ
LQQQGKAGKILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGS
GEGFNVNVAWAGGLDPPMGDPEYLAAFRTVVMPIAREFSPDLVLVSAGFDAAEGHPPPLG
GYHVSAKCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDPLSEEG
WKQKPNLNAIRSLEAVIRVHSEYWGCMQHLASCPDSWVPRVPGADAEEVEAVTALASLSV
GILAEERTSVQLVEEEEPMNL
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaccccggcgctgatgggacccaggtgagcccgggtgcccacggccccagcctc
cctggcacaggctgcccccggccacgcacagacacgccaggccctcagccccaacccatg
gacctgcgggtggggcagcggcccctggtggagcccccgccggagccctcgctgctggcc
ctgcagcacacccagcgcctgccccatcacctcttcctgggggccgtgcagcctcagcgc
tcggtggagcccatgaggctctcaatggacacgatgcccgagttgcaggtggggcagcag
gagcaagagctgcggcagcttctcaacaaggacaagagcaagcggagtgccgtagccagc
agtgtggtcaagcagaagctggcagaggtgatcctgaagaagcagcaggcagccttagag
aaaacagttcatcccaacagccccagcgtcccctacagaactctcgagcccttggagacg
gaaggagctgcccgttccatgctcagcagcttcctgcctcccgttcccagcctgcccagc
gaccccccagaacactttcctctgcgtaagacagtctctgagcccaacctgaagctgcgt
tacaagcccaagaagtccctggagcggaggaagaaccccctgctccggaaggagagtgcc
ccgccgagcctccggcggcggccggcagagaccctcggcgactcctcccccagtagcagc
agcacgccggcgtcagggtgcagctcccccaatgacagcgagcatggccccaacccagtc
ctgggctccgaggcgctcttgggccagcggctgcggctgcaggagacctctctggccccg
ttcgccttgctgcccacaatcacgctggggctgcccgcccctgccagggctgatggtgac
cgcaggacccatccgactctgggcccccggggaccggtcctggggnagccccatgctccc
ctctttctgccccacggcctggagcccgaggccgggggccccctgccctcccgcctgcag
cccattctcctcctggatccctcagtctctcacgcccccctgctgactgtgcccgggctt
gggcccctgcccttccactttgcccagtccttaatgaccagcgagcggctctccgggtca
ggcctccaccggcccctgagccggacccgctcagagcccctgcccccaagcgcaccgctg
ggtgccttgcagccccgcctggagcggctcaaacctcatgtccagctgatcaagaggcca
gccaagccgagtgagaagccccgactgcggcagataccctcagccgaggacctggagacg
gacgctgggggactggggccagtgggggaggatggcctggaacacagggagtccagccac
gggcagcatgaggccaggggccctgttcctctgcagcagcaccagcaggtgttcctctgg
gagcagcagcgactggccgggcgactgccccggggaggcgctggggaccccgtgctgctt
cccctggcccagggcggtcaccggcccctgtccagggctcagtcgtccccagccgcaccc
gcctcactgccaaccccggagcctcccagccaggcccgtgtcctgcccagctcagagacc
cccaccaggaccctgcccttcaccacagggctggtttatgactcggtaatgctgaagcac
cagtgctcctgtggggacaacagcaggcatccggagcacgcaggccgcatccaaagcatc
tggtcccggctgctggagcgggggctccggagccagtgtgagtctctccggggccggaag
gcctccctggaggagctgcagtctgtgcactccgagcgccacgtgctcctctatggcacc
aacccgctcagccgcctcaaactggacaatgggaagctggcagggctcctggcacagcgg
atgtttgtgatgctgccctgtggtggggttggggtggacaccgacaccatctggaatgag
ctgcactcctccaacgcggcccgctgggcggcaggcagcgtcaccgacctcgccttcaaa
gtggcctcccgggagctcaagaacggttttgctgtggttcggcccccaggacaccacgca
gaccattccacagccatgggcttctgcttcttcaactcggtggccatcgcctgccggcag
ctgcaacaacaaggcaaggccggcaagatcctcattgtggactgggacgttcaccacggc
aatggcacccagcagaccttctaccaggaccccagtgtgctctacatctcccttcatcgc
catgacgatggcaacttcttcccgggcagcggggctgtggatgaggtgggagctggcagc
ggtgagggcttcaatgtcaacgtggcctgggctggaggtctggaccccccaatgggggat
cccgaatacctggctgccttcaggacggtcgtgatgcccatcgcccgagagttctctccg
gacctggtcctcgtgtccgcgggctttgatgctgccgagggccacccgcccccgctgggt
ggctaccatgtctccgccaaatgttttggctacatgacgcagcagctgatgagcttggcg
ggaggtgcggtggtgctggccttggagggcggccatgacctcacagccatctgtgacgcc
tccgaggcctgtgtggctgctcttctaggcaacaaggtggatcccctctcagaagaaggc
tggaaacagaaacccaacctcaacgccatccgctccctggaagctgtgatccgggtgcac
agtgaatactggggctgcatgcagcacctggcctcctgtccagactcctgggtacccagg
gtgccaggggccgacgcagaggaagtggaggcagtgactgcactggcatccctctccgtg
ggcatcctggctgaagagcggacctcagtgcagctggtggaggaggaagaacccatgaat
ctctaa

DBGET integrated database retrieval system