KEGG   Sus scrofa (pig): 100738589
Entry
100738589         CDS       T01009                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04115  p53 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04218  Cellular senescence
ssc04310  Wnt signaling pathway
ssc04340  Hedgehog signaling pathway
ssc04371  Apelin signaling pathway
ssc04390  Hippo signaling pathway
ssc04510  Focal adhesion
ssc04530  Tight junction
ssc04630  JAK-STAT signaling pathway
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04934  Cushing syndrome
ssc05160  Hepatitis C
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100738589 (CCND1)
   04340 Hedgehog signaling pathway
    100738589 (CCND1)
   04390 Hippo signaling pathway
    100738589 (CCND1)
   04371 Apelin signaling pathway
    100738589 (CCND1)
   04630 JAK-STAT signaling pathway
    100738589 (CCND1)
   04068 FoxO signaling pathway
    100738589 (CCND1)
   04151 PI3K-Akt signaling pathway
    100738589 (CCND1)
   04152 AMPK signaling pathway
    100738589 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100738589 (CCND1)
   04115 p53 signaling pathway
    100738589 (CCND1)
   04218 Cellular senescence
    100738589 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100738589 (CCND1)
   04530 Tight junction
    100738589 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100738589 (CCND1)
   04921 Oxytocin signaling pathway
    100738589 (CCND1)
   04919 Thyroid hormone signaling pathway
    100738589 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100738589 (CCND1)
   05206 MicroRNAs in cancer
    100738589 (CCND1)
   05205 Proteoglycans in cancer
    100738589 (CCND1)
   05203 Viral carcinogenesis
    100738589 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100738589 (CCND1)
   05212 Pancreatic cancer
    100738589 (CCND1)
   05225 Hepatocellular carcinoma
    100738589 (CCND1)
   05226 Gastric cancer
    100738589 (CCND1)
   05214 Glioma
    100738589 (CCND1)
   05216 Thyroid cancer
    100738589 (CCND1)
   05221 Acute myeloid leukemia
    100738589 (CCND1)
   05220 Chronic myeloid leukemia
    100738589 (CCND1)
   05218 Melanoma
    100738589 (CCND1)
   05219 Bladder cancer
    100738589 (CCND1)
   05215 Prostate cancer
    100738589 (CCND1)
   05213 Endometrial cancer
    100738589 (CCND1)
   05224 Breast cancer
    100738589 (CCND1)
   05222 Small cell lung cancer
    100738589 (CCND1)
   05223 Non-small cell lung cancer
    100738589 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100738589 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100738589 (CCND1)
   04934 Cushing syndrome
    100738589 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100738589 (CCND1)
   05160 Hepatitis C
    100738589 (CCND1)
   05162 Measles
    100738589 (CCND1)
   05163 Human cytomegalovirus infection
    100738589 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100738589 (CCND1)
   05169 Epstein-Barr virus infection
    100738589 (CCND1)
   05165 Human papillomavirus infection
    100738589 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100738589 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100738589
NCBI-ProteinID: XP_020938345
LinkDB
Position
2
AA seq 295 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCSPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSNSFLSYHRLTRFLSRVIRCD
PDCLRACQEQIEALLESSLRQAQQQTLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgatcgggtgctgcgggccatgctcaaggcggaggagacctgctcgccc
tccgtgtcctacttcaagtgcgtgcagaaggaaatcctgccttccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtccctggagcccgtgaaaaagagccgcctgcag
ctgctgggagccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagttgtgcatctacaccgacaactccatccggccggacgagctgctgcaaatg
gagctgctcctggtgaacaaactcaagtggaacctggcggccatgaccccgcacgacttc
atcgagcacttcctctccaaaatgccggtggccgaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgtcgccctctgtgccacagacgtgaagttcatttccaacccgccc
tccatggtggccgccgggagcgtggtggcggccgtgcaaggtctgcacctgggaagttcc
aacagcttcctgtcctaccaccgcctgacgcggttcctctccagggtgatcaggtgtgac
ccggactgcctccgcgcctgccaggagcagatcgaagcccttctggaatccagcctgcgc
caggcccagcagcagaccttggaccccaaggccgcggaggaggaggaggaagaggaggag
gtggacctggcctgcacgcccaccgatgttcgcgacgtgaacatttga

KEGG   Sus scrofa (pig): 397162
Entry
397162            CDS       T01009                                 

Gene name
CCND2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04115  p53 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04310  Wnt signaling pathway
ssc04340  Hedgehog signaling pathway
ssc04390  Hippo signaling pathway
ssc04510  Focal adhesion
ssc04630  JAK-STAT signaling pathway
ssc04917  Prolactin signaling pathway
ssc05162  Measles
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    397162 (CCND2)
   04340 Hedgehog signaling pathway
    397162 (CCND2)
   04390 Hippo signaling pathway
    397162 (CCND2)
   04630 JAK-STAT signaling pathway
    397162 (CCND2)
   04068 FoxO signaling pathway
    397162 (CCND2)
   04151 PI3K-Akt signaling pathway
    397162 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397162 (CCND2)
   04115 p53 signaling pathway
    397162 (CCND2)
   04218 Cellular senescence
    397162 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    397162 (CCND2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    397162 (CCND2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397162 (CCND2)
   05202 Transcriptional misregulation in cancer
    397162 (CCND2)
   05206 MicroRNAs in cancer
    397162 (CCND2)
   05203 Viral carcinogenesis
    397162 (CCND2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397162 (CCND2)
   05162 Measles
    397162 (CCND2)
   05169 Epstein-Barr virus infection
    397162 (CCND2)
   05165 Human papillomavirus infection
    397162 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 397162
NCBI-ProteinID: NP_999253
Ensembl: ENSSSCG00000000727
UniProt: Q8WNW2
LinkDB
Position
5
AA seq 288 aa
MELLCCEVDPVRRAVPDANLLHDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAINYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQPNEKLSLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEDVSSLTGDALVDLLARITNTDV
DCLKACQEQIEVVLLNSLQQYRQDQDGSKSEDELDQASTPTDVRDIDL
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggacccggtccgcagggccgtgccggacgccaacctg
ctccacgacgaccgcgtgttgcagaacttgctgaccatcgaggagcgctaccttccccag
tgctcctacttcaagtgcgtgcagaaggatatccagccctacatgcgcaggatggtggcc
acctggatgctggaggtctgtgaggagcagaagtgtgaagaagaggtcttccctctggcc
atcaattacctggaccgcttcttggccggagtcccaactccgaagacccatctgcagctt
ctgggggccgtgtgcatgttcctggcgtccaagctcaaagagaccattccgctgacggct
gagaagttgtgcatttacaccgacaactccatcaagcctcaggagctgctggagtgggag
ctggtggtgctgggcaagttgaagtggaacctggcggctgtcaccccccacgacttcatc
gagcacattcttcgcaagctgcctcagcccaatgagaagctgtctctgattcgcaagcac
gcgcagactttcatcgctctgtgcgccactgacttcaagttcgccatgtacccgccgtcg
atgattgcaactggaagtgtgggggccgccatctgcgggctccagcaggacgaggacgtg
agctcgctcacgggtgacgccctggtggacctgctggccaggatcaccaacaccgacgtg
gattgcctcaaagcctgccaggagcagattgaggtcgtgctgctcaacagcctgcagcag
taccgtcaggaccaggacggatccaagtcggaggacgagctggaccaagccagcacccct
acagacgtgcgggatattgacctgtga

KEGG   Sus scrofa (pig): 780426
Entry
780426            CDS       T01009                                 

Gene name
CCND3
Definition
(RefSeq) G1/S-specific cyclin-D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04110  Cell cycle
ssc04115  p53 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04510  Focal adhesion
ssc04630  JAK-STAT signaling pathway
ssc05162  Measles
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    780426 (CCND3)
   04390 Hippo signaling pathway
    780426 (CCND3)
   04630 JAK-STAT signaling pathway
    780426 (CCND3)
   04151 PI3K-Akt signaling pathway
    780426 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    780426 (CCND3)
   04115 p53 signaling pathway
    780426 (CCND3)
   04218 Cellular senescence
    780426 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    780426 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    780426 (CCND3)
   05203 Viral carcinogenesis
    780426 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    780426 (CCND3)
   05164 Influenza A
    780426 (CCND3)
   05162 Measles
    780426 (CCND3)
   05169 Epstein-Barr virus infection
    780426 (CCND3)
   05165 Human papillomavirus infection
    780426 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 780426
NCBI-ProteinID: NP_001072146
UniProt: Q007T4
LinkDB
Position
7
AA seq 292 aa
MELLCCEGTRHAPRAGPDPRVGGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHSVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLALILHRLALPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSTSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREAAQTSPSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgagggcacccggcacgcgccccgggccgggccggacccgcgg
gtggggggggaccagcgggtcctgcaaagcctgctccgcctggaggagcgctatgtgccc
cgcgcctcctacttccaatgtgtgcagagggagatcaagccgcacatgcggaagatgctg
gcgtactggatgctggaggtgtgtgaggagcagcgctgtgaggaggaagtcttccccctg
gccatgaactacctggatcgctacctgtcctgcgtccccacccgcaaggcgcagttgcag
ctcctgggtgcggtctgcatgctgctggcctccaagctgcgcgagactacgcccctgacc
atcgaaaaactgtgcatctacacggaccactctgtctctccccgccagctgcgggattgg
gaggtgctggtcctggggaagctcaagtgggacctggccgctgtgattgcccatgatttc
ctggctctgattctccaccggctcgctctgccccgtgaccgacaggccttggtcaaaaag
cacgcccagacctttttggccctctgtgctacagattacacctttgccatgtacccgcca
tccatgatcgccacgggcagcattggggctgcagtgcaaggcctgggtgcctgctccaca
tctggagatgagctcacggagctgctggctgggatcacaggcactgaagtggactgcctg
cgggcctgtcaggagcagatcgaagctgccctcagggagagcctcagggaagccgcccag
acctcccccagcccagcgcccaaagcccccaggggctccagcagccaggggcccagccag
accagcactcccacagatgtcacagccatccacctgtag

DBGET integrated database retrieval system