KEGG   Sus scrofa (pig): 100738625
Entry
100738625         CDS       T01009                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05200  Pathways in cancer
ssc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100738625 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100738625 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100738625 (NKX3-1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    100738625 (NKX3-1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 100738625
NCBI-ProteinID: XP_003483439
Ensembl: ENSSSCG00000028216
UniProt: A0A287BML5
LinkDB
Position
14
AA seq 247 aa
MLRAPELRPGEGGTAGCSPRAAPPIQSKPLTSFLIQDILRDRTEQCGGQAGSPQPQPPPQ
PRRQPDQRRDPEPEPKGGRGSAGAPEDHRSARPRAARREAEPPAETEPDRHLETYLLDCE
NTPGALPSLPPTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQ
VKIWFQNRRYKTKRKQLTSDLGDLEKHPSLPALKEEGFSRASLIAMHHTYPYYPYLYCLG
GWSPAFW
NT seq 744 nt   +upstreamnt  +downstreamnt
atgctccgggctcccgagctacggccgggggagggggggacggcaggctgcagcccccgc
gccgcaccacccatccagtccaagccgcttacctccttcctcatccaggacatcctacgg
gaccgcacggagcagtgcggaggccaagcgggcagcccgcagccgcagccaccgccgcag
ccccggcgccagccagaccagaggcgagaccctgagccggagcccaagggaggaagaggc
agcgccggggcgcctgaggaccataggagcgcccggccccgcgccgcgcggagggaggcc
gagccgccggcagagaccgagccagataggcaccttgagacttatctgctggactgtgaa
aacactccaggcgccttgccgagcctgcccccaacccccaagcagccgcagaagcgctcc
cgggccgccttctcccacactcaggtcatagagttagagaggaagttcagccaccagaag
tatctgtcggcccccgaaagggctcatctggccaagaacctcaagctcacggagacccaa
gtgaaaatatggttccaaaatagacgctataaaaccaagcggaagcagctcacctcggac
ctgggggacctggagaagcacccctccttgccggctctgaaggaggaaggcttctctcgg
gcctccctcatcgccatgcatcacacctacccttactacccctacctttactgcttggga
ggctggagcccagctttctggtaa

DBGET integrated database retrieval system