KEGG   Sus scrofa (pig): 100738636Help
Entry
100738636         CDS       T01009                                 

Gene name
EPN1
Definition
(RefSeq) epsin-1 isoform X1
  KO
K12471  epsin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100738636 (EPN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100738636 (EPN1)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100738636 (EPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ENTH ANTH UIM VHS
Motif
Other DBs
NCBI-GeneID: 100738636
NCBI-ProteinID: XP_020950710
LinkDB All DBs
Position
6
AA seq 592 aa AA seqDB search
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMI
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQG
VNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS
SGEEELQLQLALAMSKEEADQPPSCGPEDDVQLQLALSLSREEHDKWDLVSNIPRQDQSG
CWEERIRRGDDLRLQMAIEESRRETAGQEESSLMDLADVFTAPAPPPATDPWGGPVPTAT
AIPTAAPVSDPWGGPPVPPAADPWGGPATTPASGDPWRPAAPAGPPVDPWGGTQAPAAGE
GPTPDPWGSSEGGAPVGGPPASDPWAPAPAFSDPWGGSPAKPSTNGTTVVGGFDAEPDEF
SDFDRLRTALPTSGSSTGELEMLAGEVPARSPGAFDMSGVGGSLAEAVGSPPPTATPTPT
PPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPSGAPATGPSITNPFQPAP
PATLTLNQLRLSPVPPVPGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcgtcgctgcggcgccagatgaaaaacatcgtccacaactactcggaggct
gagatcaaggtgcgcgaggccacgagcaacgacccctggggcccgtccagctccctcatg
tccgagatcgccgacctcacctacaacgtggtggccttctcggagataatgagcatgatc
tggaagcggctcaacgaccacggcaagaactggcggcacgtgtacaaggccatgacgctg
atggagtacctcatcaagacgggctcggagcgcgtgtcccagcagtgcaaggagaacatg
tacgccgtgcagacgctcaaggactttcagtacgtggaccgcgatggcaaggaccagggc
gtgaatgtgcgggagaaggccaagcagctggtggccctgctgcgggacgaggaccggctg
cgggaggagcgtgcccacgcgctcaagaccaaggagaagctggcgcaaaccgccacggcc
tcttccgcagccgtgggctccgggcccccacccgaggcagagcaggcctggccgcagagc
agcggggaggaggagctgcagctccagctggccctggccatgagcaaggaggaggctgac
cagcccccgtcctgcggccccgaggatgacgtccagctccagctggcccttagtttgagc
cgtgaggagcacgataagtgggaccttgtgtcaaacatccccagacaggatcagtctgga
tgctgggaggagcggatccgccgcggggatgacctgaggctgcagatggccatcgaggag
agcaggagggagacggcgggccaggaggagtcatccctcatggatcttgctgacgtcttc
acggccccagctcctcctccggccacagacccctggggggggccagtgcccacggccaca
gccatccccacagctgcccctgtctcggacccttgggggggaccccctgtccctccggct
gctgatccctggggtggcccggccactacaccagcctctggggacccctggaggcctgct
gcccctgcggggcccccggtggatccttggggtgggacccaggcccctgcggctggagag
gggcccacccctgacccgtgggggagctcagagggtggggctccggtcggcggacccccg
gcctccgatccctgggccccggccccggccttctcagacccctggggggggtcacctgcc
aagcccagcaccaatggcaccacagtggtcgggggctttgacgcagagccggacgagttc
tccgacttcgaccgactgcgcacggccctgccgacctctgggagcagcacgggggagctg
gagatgcttgctggagaggtacctgctcgcagtcctggcgccttcgacatgagcggggtt
gggggctctctggcggaggccgtggggagcccgccgcccacagccaccccaacccccacg
ccgcccacacggaagacaccagagtcatttctggggcccaatgcagccctggtcgacctg
gactcgctggtcagccggccgggccctacaccgccgggcgccaaggcctccaaccccttc
ctgccgagcggagccccagccaccggcccctccatcaccaaccccttccagcccgcgccc
cccgccacgctcaccctgaaccagctccggctcagcccggttcccccggtccctggagca
ccgccaacgtacatctctcccctcggcgggggccctggcctgccacccatgatgcccccg
ggccccccggcccccaacactaaccccttcctcctataa

DBGET integrated database retrieval system