KEGG   Sus scrofa (pig): 100738665Help
Entry
100738665         CDS       T01009                                 

Gene name
DOT1L
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00310  Lysine degradation
ssc05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100738665 (DOT1L)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    100738665 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100738665 (DOT1L)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100738665 (DOT1L)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100738665 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 100738665
NCBI-ProteinID: XP_020939844
Ensembl: ENSSSCG00000013457
LinkDB All DBs
Position
2
AA seq 1720 aa AA seqDB search
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNTTTPTKVP
ESKAAVPADTPVDSGAEEEKAGATTIKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMSST
NPERKPKKTQSALDLLHAQTVSRAASPSPQDAHRPPHSPFYQLPPSVQRHPPEQLLLAPT
PPALQKLLESFKIQYLQFLAYTKTPQYKANLQQLLDQEKEKNARLLGAAQQLFGHCQAQK
EEIKRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQTEQLEKGNRELRSRSLQLL
KARCEELKLDWSTLSLENLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLK
SCVPPDDTLSAHLRGRGGLAREPEAEPGRLRLELDCAKFSLPHFSSTSPELSMNGHAASY
ELCSALSRPSPKQNTPQYLTSPLDQEVVPCTPSHGGRPRLEKLSGLALPDYTRLSPAKLV
LRRHLSQDHVAGNKAATSDLHPRVEPTKENGLPYHSPGITNGIKLSPQDPRPSSPTGLQM
TGEKGSEKGVRERAYASSGEAITSLPVSIPLSTVQPSKLPVSIPLASVVLPSRAEKVRST
PSPGPQARETSTTLEKQMGANAHGAGGSAAGGKGLALPPTGFTYAGSMAISGTLAGSPVP
LAPGAEPPALDESSSSGSLFATMGSRSSTPQHPPLLTQPRSCGSASPAPQLCTSPRLATQ
GPLPDASKGDLPAEAGFSDPESEAKRRVVFTIAAGAGSAKQSPSSKHSPLPSGTRGDSGQ
SHGQDSRKRGRRKRASAGTPSLSSGVSPKRRALPSVAGLFTQSSGSPLNLNSMVNNINQP
LEITAISSPESSLKSSPVPYQDNDQPPVLKKEKPLSQTNGAHYSPLTSDEEQGSEDEPGS
ARIERKIATISLESKSPPKTLENGGGLAGRKVPPASEPVNSSKWKSTFSPISDLGLSRAA
DSPLQASSTLSHSSLFAFRPSLEEPSSADTKLAAHSRKSFSGTLPAAGGLSPSSHPASGF
ALGGGLATDLSLHSFSDGASLSHKAPEAAGLGAPLSFPAPRGKEGGASEPGPFSNKRQLD
GLGPKGEGGLPTCGPTDKASLVHSKAGKGRDREPDVKNGHNLFMAAATAPPGGLLSGPGL
TPAVSSAGSTAPATQTHRPFLGAFAPSPQFTLGPMSLQANLGPSVLQSLFSSVPAAGLVH
GSSAATRLTNSHAMGSFSSGVAGGAVGGVFNHAVPPASAHPFGASFGSGAACRSATLSLT
PLQAVASTPASSFQAPSSAEPRPPPPPPHLGRPPPGQPALHAPPPPNAALPPPPALLPAN
SEPVLLQNLASLPANQAFLPASSAASLPPANASVSIKLASLPHKVSRPSFTVHHQPLPGL
ALAQATPMIPQASSTGPPAVWVSLGMPPPYAARLAGVKPR
NT seq 5163 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagctggagctgaggctcaagtcgcccgtgggggccgagcccgccgtctac
ccgtggccgctgccggtctacgataaacaccacgatgctgctcacgaaatcatcgagact
atccgatgggtctgtgaagaaatcccagatctcaagcttgctatggagaattatgtttta
atcgactacgataccaaaagctttgaaagcatgcagaggctctgtgacaagtacaaccgg
gccatcgacagcatccaccagctgtggaagggcaccacgcagcccatgaagctgaacacg
cggccatccactggactcctgcgccacatcctgcagcaggtctacaaccactcggtgact
gaccccgagaagcttaacaactatgagcccttctccccggaggtgtatggggagacctcc
ttcgacctggtcgcccagatgatcgatgaaatcaagatgaccgaggatgacctgtttgtg
gacctgggcagcggagtgggccaggtcgtgctgcaggtcgccgcagccaccaactgcaaa
catcactatggtgtcgagaaagccgacatcccagccaagtacgcggagaccatggaccga
gagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacactggaaagg
ggagatttcctctcggaggagtggagggagcggattgccaacacgagtgttatatttgtg
aataactttgcctttggtcctgaggtggatcaccagctgaaggagcggtttgcaaacatg
aaggaaggtggcagaatcgtgtcctcaaagcccttcgcacctctcaacttcaggataaac
agtcgaaacttgagtgacattggtaccatcatgcgtgtggtggagctctcgccgctgaag
ggctcagtgtcatggacggggaagccagtctcctactacctgcataccatcgaccgcacc
atacttgaaaactatttttctagtctgaaaaacccaaaactcagggaggaacaggaggca
gctcggcgccggcagcagcgagaaaataagagcaacacgaccaccccgaccaaggtgccc
gagagcaaggcggccgttcccgcagacacccccgtggactctggtgctgaggaagagaaa
gctggggcgaccaccatcaagaagccatctccctccaaagcccggaagaagaagctgaac
aagaagggccggaagatggccggccggaagcgcgggcgccccaagaagatgagctccacg
aaccccgagcgcaagcccaagaagacccagagcgcactggacctgctgcatgcccagacc
gtgtcgcgggcggcatcaccctcgccgcaggatgcgcacaggccacctcacagcccattc
taccagctacctcccagcgtgcagcggcacccccctgagcagctgctgctggcacctacc
ccgcccgcactgcagaagctgctagaatccttcaagattcagtacttacagttcctggcg
tacacaaagactcctcagtacaaagccaacctgcagcagctgctggaccaggagaaggag
aagaacgcccggttgctgggcgccgcacagcaactgttcggccactgccaagctcagaaa
gaggagatcaagaggctcttccagcagaaactggacgagctgggcgtgaaggcgctgacc
tacaatgacctgatccaagcacagaaggagatctcggctcataaccagcagctgcgggag
cagacagagcagctggagaagggcaacagggagctgcgaagccggagcctgcagctgctc
aaggctcgctgcgaggaactgaagttggactggtccacactgtccctagagaacctgctg
aaagagaagcaggccctgaagagccagatctcggagaagcagaggcactgcctggagttg
cagatcagcatcgtggagctggagaagagccagcggcagcaggagctcctgcagctcaag
tcctgtgtgccacccgatgacaccctgtctgcgcacctgcgggggaggggtggcctggcc
cgggagccagaggctgagcctggccggctgcgcctggagctggactgtgccaagttctcc
ctgccccacttcagcagcacaagcccggaactctccatgaatggccatgcggccagctac
gagctctgcagcgcgctcagccgaccctcgcccaagcagaacactccccagtacctgacc
tcccccctggaccaggaggtcgtgccctgcacccccagccatggcggccggccaaggctc
gagaagttgtctggcctggccctgcctgactacactaggctctcccctgccaagctggtg
ctgaggcgtcacctgagccaggatcacgtggctggcaacaaggcagccaccagcgatctg
cacccacgagtggagcccaccaaggagaatggcctcccataccacagccccggcatcacc
aacggcatcaagctgagcccccaagatcctcggccctcgtcccccacaggcttacagatg
acgggagagaagggcagcgagaagggtgtgagggagcgcgcctacgccagcagtggggag
gccatcaccagcctgcctgtcagcatcccgctcagcaccgtgcagcccagcaagctgcct
gtcagcatccctctggccagcgtggtgctgcccagccgcgctgaaaaagtgagaagcacc
cccagcccaggcccacaggcccgagagacctccaccactcttgagaagcagatgggtgct
aatgcccatggcgccgggggcagtgctgccgggggcaaaggtcttgccctgcctcccaca
ggcttcacctacgctggctcaatggccatcagtgggaccctggctggcagcccggtgcca
cttgcccctggagctgagccccccgccttggatgagtcctccagctccggaagtctcttt
gccaccatggggtcccgcagctccaccccgcagcacccgcccctgctgacacagcctcgc
agttgtggctctgcctcacccgcccctcagctctgcaccagcccccggctggccacccag
ggcccgctccctgacgccagcaaaggggacctccccgctgaggctggcttctcagaccca
gagagcgaagccaagaggagggtcgtgttcaccatcgcagccggtgctggcagtgccaag
cagtcgccatccagcaagcacagccccctgccatcgggcactcgcggggacagtggccag
agccatggacaggacagccgcaagcggggcagaagaaagcgggcatcggcagggaccccc
agcctgagctcgggcgtgtcccccaagcgccgggccctaccatctgtcgctggcctcttc
actcagtcttcagggtcccccctgaatctcaactccatggttaacaacatcaaccagcct
ttggagatcacggccatctcatcccctgagagctctctgaagagttcccctgtcccctac
caggacaatgaccagccccccgtgctcaagaaggaaaagcccctgagccagaccaacggg
gcccactactccccactgacctcggacgaggagcagggctcggaggatgagcccggcagt
gccagaatcgagagaaaaattgcaacaatctccttagaaagcaaatctcctccgaaaacc
ttggaaaatggtggcggcctggcgggaaggaaggtgccgccggccagcgagccagtcaac
agcagcaagtggaagtccacgttctcgcccatctccgaccttggcctgtccagggcggct
gatagcccgttgcaggccagctccactctgagccacagctccctgtttgctttccggccc
agcctggaggagcccagctcagccgacaccaagctggccgcccactccaggaagagcttc
tcgggcaccctgccagcggcaggcgggttgagtcccagcagccaccctgccagcggcttt
gcccttggcgggggcctggcaaccgacctcagtttacacagcttcagtgatggtgcttct
ctctcccacaaggcccccgaggcggctggcttgggtgcgcccttgagcttccctgcccca
cggggcaaggagggcggcgcctcagaacctggccccttctcgaacaagaggcagctggat
ggactgggcccaaagggcgaggggggcctgcccacctgcgggcccacggacaaggcctct
ctggtgcacagcaaggcgggcaagggccgtgaccgtgagcccgacgtgaagaatggccac
aacctcttcatggccgccgccaccgcaccccctgggggcctcctcagtggcccaggcctc
accccggcagtgtcctcagcaggcagcacggccccggccacccagacacaccggcccttc
ctgggcgcctttgcccccagcccgcagttcacactgggccccatgtccctgcaggccaac
ctgggcccatccgtgctgcagtccctgttcagttccgtgcccgccgccggcctggtgcat
ggctcgtccgccgccaccagactgaccaactcgcacgccatgggcagcttctcctccggg
gtcgctggcggcgcagttggaggtgtctttaaccacgcggtgcctcccgcctccgctcat
ccgtttggagccagtttcggcagtggggctgcatgtcgcagcgccacgctgagcttaacc
ccgctgcaggcggtggccagcaccccggcctcttcctttcaggccccgtcctctgcggag
ccgaggccgcccccaccccctccccacctgggccggccccctccagggcagcccgccctt
cacgcaccgcccccccctaacgctgccttgcctcctccccccgcgctgctcccggctaac
tctgagcccgtgcttctgcagaaccttgcgtccctcccggctaaccaagctttcttacct
gcctcctctgccgcctctctgccgcctgctaacgcctctgtgtccatcaagctggcctcc
ctcccgcacaaggtgtcccgcccctccttcacggtgcaccaccagcccctgcctgggctg
gccctggcccaggccacacccatgatcccgcaggccagctccacggggccgcccgccgtg
tgggtttcccttggcatgccgcctccatatgccgcgcgccttgcgggggttaagccgcga
taa

DBGET integrated database retrieval system