KEGG   Sus scrofa (pig): 100739064
Entry
100739064         CDS       T01009                                 

Gene name
NLRP4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100739064 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ssc04054]
    100739064 (NLRP4)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100739064 (NLRP4)
Pattern recognition receptors [BR:ssc04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100739064 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH AAA_16 LRR_6 AAA_25 AAA_22 AFG1_ATPase VirE SRP54
Other DBs
NCBI-GeneID: 100739064
NCBI-ProteinID: XP_020950729
LinkDB
Position
6
AA seq 984 aa
MASSFFPDFGLMWYLEELKRDEFKKFKDLLRKEPLELGLKPLPWGEVKRATRENLAKLLT
VNFEEEQAWNVTLSIFHKIGRKDLCEKAKKEITGHAKTYQAHIKEKFSNLWFQEARTRIH
EYLDQENARKEQESLQRLFAPKRTGKWTRTVILLGPQGVGKTTYLVKLMLAWAEGNLFRE
RFSYVFYFCCQELKQLTKTSLAALISRDWSDSLAPLQEITSQPERLLFIIDSFEELKHDL
NEPESDLCSDWTEKRPVQVVLSSLLRKKIFPESSLLIAAKPVYPRKLELSLDGPEIRELL
GFSETDRKLYFYTIFRDRNRAMEAFRLVRENKQLFCMCQIPVLCWAVCTCLKQEMDKGRD
LAPTCQHTTSIFTSFVFGLFTPKGAGCPDQQSQRLLKGLCFLAAEGMWTDTFVFSEEDLE
RNGLCDSDIPALLGLKVLQKCRAFEKSYAFIHMCIQEFCAAMFYLLSRHAQHPNPAVGSL
EALLLTFLKRVNVYWIYLGCFLFGLLREEEQKKLDAFFGIHLAQEIQQKCHQFLQRIAEN
EHPWKQVDFLALCYCLYEMRNEDFVQWAMDFFQAVKLSIIDDADLVVSAYCLKHCSGLRT
LWVSALHDFEEEDEEGSTSRYSAIHWNQVCSALITNENLREFRMSDSSLHGFTFVTLCDQ
LKHPRCRLQKLHLNNVSFPRGSRLFFEVLTHSPHLKCLNLSGTKLSRNAVKLLCEALNNP
TCNIEELLLARCWLSVEDCSAFSQILRSSRKLLNLNVSRNYLVPGAPLLCKVLCKPDCAL
RVLDLGHCYLDQHCWTNLYEVLLCNKSLIHLDLTSNILKDKKLKLLCEALKEPGCHLRSL
WILKCLITAAGCRELASVLPVNPNLRNLQLGYNDIEDTGVKLLCEGLTHPSCRLEILGLG
ECKLTSACCQDISSVLTSSKTLRILNLGGNALDLSGMVVLCEALRHPECTLQVLSLKKEE
LDEETQRFLMDEEKKNPKWPIIGE
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggcatcatctttctttcctgactttggcctgatgtggtacctggaggagctcaaaagg
gatgaattcaaaaaattcaaggatctcctcaggaaagagcctcttgaattgggactcaag
ccacttccctggggtgaagtaaaaagggccacacgggagaatcttgcaaagctcctgacg
gtgaatttcgaggaagaacaagcctggaatgtgaccctcagcatcttccacaagatcggc
agaaaggacctctgtgagaaggccaagaaggagattacaggacatgcaaagacatatcaa
gctcacataaaggagaaattctccaacctatggttccaagaagcccgcaccaggattcat
gagtatcttgaccaggaaaatgcccgtaaggaacaggaaagtctacaacggctttttgct
cctaaaagaactgggaaatggacacggaccgtgatcctccttggaccacaaggggttggg
aagacaacatacctggtaaagctgatgctggcctgggcggagggcaacctctttcgagag
agattctcttatgtcttctacttctgctgccaggaactgaagcagctgacaaagacgagc
ttggctgcattgatttctagagactggtctgactcccttgctcctttgcaagaaatcaca
tcccaaccagagaggctcttgttcatcattgatagttttgaagaactgaagcatgacttg
aacgagcctgagtcggatctgtgcagcgactggacggagaagcggccggtgcaggtggtc
ctcagtagcctgctgaggaagaaaatcttccccgagtcctccttgctcattgcagccaag
cctgtgtacccacggaaactagagctcagcttggacgggccagaaattagagaactcctg
ggattcagtgagactgataggaagctgtatttctacaccatctttcgagacaggaataga
gccatggaagccttcaggttggtgagggaaaacaaacagctcttttgcatgtgccaaatc
cctgtcctttgctgggctgtgtgtacttgcctgaaacaagagatggacaaggggagagat
ctggcgcccacctgccaacacaccacctctatttttacctcttttgtctttggcctgttc
acacccaagggtgctggttgtccagatcagcaaagccaacgtctgctgaagggcttgtgc
ttcctggctgcagagggcatgtggactgacacgtttgtatttagtgaagaagatctcgag
agaaatgggttatgtgattcggacatccctgcgctactgggcttaaaggtgcttcagaag
tgcagggcctttgagaagtcctacgccttcatccacatgtgcatccaggagttctgtgct
gccatgttctatcttctgagtcgtcacgcccaacaccccaaccccgctgttggctctctc
gaggcactgctgctgacctttttaaagagggtaaatgtatactggatttatttggggtgc
ttcctgtttggccttttacgtgaagaggaacaaaaaaagctggatgcattttttggcatc
cacctggcccaggagatccagcagaagtgtcaccagttcttgcaaaggatagctgagaat
gaacatccctggaaacaggtagatttcttggcattgtgttactgtctgtatgagatgcgg
aatgaagacttcgtacagtgggcaatggacttcttccaggctgttaaattatccatcatt
gatgatgccgacctggtagtttctgcctactgcttaaaacactgttctggcttgaggaca
ctttgggtttctgccctacatgactttgaagaagaggatgaagaaggttccacgtcacgt
tacagtgccatccactggaatcaagtctgttctgcgctcattacaaacgagaacctcaga
gaattccgaatgagtgacagcagcctccatggcttcacttttgtgactttgtgcgatcag
ctgaagcatcctcgctgtcgccttcaaaagcttcacctgaataatgtctcctttccccgt
gggagccggctcttctttgaggtgctgactcacagcccacatttgaaatgcctgaacctc
agtggcacgaagctctcacgcaatgctgtgaagctgctctgtgaagccttgaacaacccc
acgtgcaacatcgaagagctgctgctggcaagatgttggctctcggtggaggactgttca
gccttttcccagatcctaaggagcagcaggaaactgctgaatcttaatgtctcacgcaac
tacttggtcccaggggctcccctgctgtgtaaggtcctgtgtaagccagactgtgctctg
agggtcttggatttaggtcactgctacctcgatcaacactgctggacaaacctctatgaa
gttcttctgtgtaacaaaagtttgatccatctggacctcacatcaaatatcctgaaagat
aaaaaactgaagcttctctgtgaggccttgaaagagccaggttgccacctgcggtcactg
tggattttaaaatgtctcatcacggccgccggctgtcgagaacttgcctccgtgctccct
gtcaatccaaacctgagaaatctgcaactcgggtacaatgacatagaagataccggcgtg
aagctgctgtgtgaaggtctgacacatcccagctgtcgcttagagatacttgggctgggt
gagtgcaagctaaccagcgcctgctgccaggatatctcttctgtcctcaccagcagcaaa
actctgaggattttgaatctgggtggaaatgccttggacctcagtgggatggtggtgctt
tgcgaggccctgaggcaccccgagtgcaccctgcaggttctcagcctgaaaaaagaggaa
ctcgatgaggaaacccagagatttctgatggatgaggagaagaaaaatccaaaatggccc
atcataggtgaatga

DBGET integrated database retrieval system