KEGG   Sus scrofa (pig): 100739223Help
Entry
100739223         CDS       T01009                                 

Gene name
NEU3
Definition
(RefSeq) sialidase-3
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00511  Other glycan degradation
ssc00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100739223 (NEU3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100739223 (NEU3)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100739223 (NEU3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 100739223
NCBI-ProteinID: XP_003482613
Ensembl: ENSSSCG00000021638
UniProt: I3LRE9
LinkDB All DBs
Position
9
AA seq 428 aa AA seqDB search
MEEMTSCSFNRPLFQQEDKRGVTYRIPALLYIPPTRTFLAFAEKRSTSRDEDALHLVLRR
GVRTGHSVQWEPMKPLMEATLPGHRTMNPCPVWERKNGLVYLFFICVRGHVTECQQIVSG
RNAARLCFICSQDSGCSWSEVRDLTEEVIGPDVAHWATFAVGPGHGIQLQSGRLVIPAYT
YYIPYRFFCFRFLYKARPHSLMIYSDDLGATWHHGRLIKPTVTVECQVAEVTSRAGQPVL
YCSARTPNRCRAEALSTDHGECFQSPALNQQLCEPPHGCQGSVVSFQPLEIPSGHQDPAG
KDVPTVQQSPLLGSSWRPERGAGTLSESWLLYSHPTSKKRRVNLGIYLNQSPSEAACWSR
PWILHCGPCGYSDLAALEKEGLFGCLFECGAKQECEQIAFRLFTDREILSHVRGDCTSPD
RNSEPAQS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatgacatcgtgctccttcaaccgtcctctgttccagcaggaagacaagaga
ggggtcacctaccggatcccagccctgctctatatcccccccacccgcactttcctggcc
tttgcagagaagcgctccacgagcagggacgaggatgcactccacctggtgctgaggcga
ggggtgaggactgggcactcagtacagtgggagcccatgaagccattaatggaagccacg
ttacctgggcatcggaccatgaacccctgtcctgtgtgggagcggaagaatggcctcgtg
tacctattcttcatctgtgtgcggggccacgtcactgagtgtcaacagatcgtatcgggc
aggaatgctgcccgcctctgcttcatctgcagtcaggattctggctgttcgtggagtgag
gtgagggacctgaccgaggaggtcattggcccggatgtggcgcactgggccacatttgct
gtgggcccagggcatggcatccagctgcagtcggggaggctggtcatccctgcatacacc
tactacatcccttaccggttcttttgctttcggttcctttacaaagccaggcctcattcc
ctgatgatctacagtgatgacctaggagccacatggcaccatggcaggcttattaagccc
acggtgacagtggagtgccaagtggcagaggtgaccagtagggctggtcaacctgtgcta
tactgtagtgcccggacaccaaacaggtgtcgggcggaggcgctcagcactgaccatggt
gaatgctttcagagtccagccctgaaccaacagctctgtgagcctccgcatggctgccaa
ggcagcgtggtgagtttccagcccctggagatcccaagtgggcaccaggaccctgctggc
aaggacgttcctaccgttcaacagagccctctgctgggcagttcatggaggccagagagg
ggagctggaaccctgtcagaatcatggctcttgtactcacacccaaccagtaagaaacgg
agggtcaacctgggcatctacctcaaccagagcccctcggaggctgcctgctggtcccgc
ccctggattttgcactgtgggccctgtggttactctgatttggctgccctggagaaggaa
ggtttgtttgggtgtttgtttgaatgtggggccaagcaggagtgtgagcagattgccttc
cgcctgtttacagaccgagagatcctgagccatgtgcggggggactgcaccagccctgac
aggaactctgagccagctcaaagctaa

DBGET integrated database retrieval system