KEGG   Sus scrofa (pig): 100739349
Entry
100739349         CDS       T01009                                 

Gene name
NRAS
Definition
(RefSeq) GTPase NRas precursor
  KO
K07828  GTPase NRas
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04062  Chemokine signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04137  Mitophagy - animal
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04218  Cellular senescence
ssc04360  Axon guidance
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04540  Gap junction
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04625  C-type lectin receptor signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04714  Thermogenesis
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04730  Long-term depression
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04915  Estrogen signaling pathway
ssc04916  Melanogenesis
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04929  GnRH secretion
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05034  Alcoholism
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100739349 (NRAS)
   04012 ErbB signaling pathway
    100739349 (NRAS)
   04014 Ras signaling pathway
    100739349 (NRAS)
   04015 Rap1 signaling pathway
    100739349 (NRAS)
   04370 VEGF signaling pathway
    100739349 (NRAS)
   04371 Apelin signaling pathway
    100739349 (NRAS)
   04068 FoxO signaling pathway
    100739349 (NRAS)
   04072 Phospholipase D signaling pathway
    100739349 (NRAS)
   04071 Sphingolipid signaling pathway
    100739349 (NRAS)
   04151 PI3K-Akt signaling pathway
    100739349 (NRAS)
   04150 mTOR signaling pathway
    100739349 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100739349 (NRAS)
   04137 Mitophagy - animal
    100739349 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    100739349 (NRAS)
   04218 Cellular senescence
    100739349 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100739349 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    100739349 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100739349 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100739349 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    100739349 (NRAS)
   04660 T cell receptor signaling pathway
    100739349 (NRAS)
   04662 B cell receptor signaling pathway
    100739349 (NRAS)
   04664 Fc epsilon RI signaling pathway
    100739349 (NRAS)
   04062 Chemokine signaling pathway
    100739349 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100739349 (NRAS)
   04929 GnRH secretion
    100739349 (NRAS)
   04912 GnRH signaling pathway
    100739349 (NRAS)
   04915 Estrogen signaling pathway
    100739349 (NRAS)
   04917 Prolactin signaling pathway
    100739349 (NRAS)
   04921 Oxytocin signaling pathway
    100739349 (NRAS)
   04926 Relaxin signaling pathway
    100739349 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    100739349 (NRAS)
   04919 Thyroid hormone signaling pathway
    100739349 (NRAS)
   04916 Melanogenesis
    100739349 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100739349 (NRAS)
   04726 Serotonergic synapse
    100739349 (NRAS)
   04720 Long-term potentiation
    100739349 (NRAS)
   04730 Long-term depression
    100739349 (NRAS)
   04722 Neurotrophin signaling pathway
    100739349 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100739349 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100739349 (NRAS)
   04213 Longevity regulating pathway - multiple species
    100739349 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100739349 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100739349 (NRAS)
   05206 MicroRNAs in cancer
    100739349 (NRAS)
   05205 Proteoglycans in cancer
    100739349 (NRAS)
   05203 Viral carcinogenesis
    100739349 (NRAS)
   05230 Central carbon metabolism in cancer
    100739349 (NRAS)
   05231 Choline metabolism in cancer
    100739349 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100739349 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100739349 (NRAS)
   05225 Hepatocellular carcinoma
    100739349 (NRAS)
   05226 Gastric cancer
    100739349 (NRAS)
   05214 Glioma
    100739349 (NRAS)
   05216 Thyroid cancer
    100739349 (NRAS)
   05221 Acute myeloid leukemia
    100739349 (NRAS)
   05220 Chronic myeloid leukemia
    100739349 (NRAS)
   05218 Melanoma
    100739349 (NRAS)
   05211 Renal cell carcinoma
    100739349 (NRAS)
   05219 Bladder cancer
    100739349 (NRAS)
   05215 Prostate cancer
    100739349 (NRAS)
   05213 Endometrial cancer
    100739349 (NRAS)
   05224 Breast cancer
    100739349 (NRAS)
   05223 Non-small cell lung cancer
    100739349 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100739349 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100739349 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    100739349 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100739349 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100739349 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    100739349 (NRAS)
   05161 Hepatitis B
    100739349 (NRAS)
   05160 Hepatitis C
    100739349 (NRAS)
   05163 Human cytomegalovirus infection
    100739349 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100739349 (NRAS)
   05165 Human papillomavirus infection
    100739349 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100739349 (NRAS)
   01522 Endocrine resistance
    100739349 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100739349 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100739349 (NRAS)
   04031 GTP-binding proteins [BR:ssc04031]
    100739349 (NRAS)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100739349 (NRAS)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100739349 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   100739349 (NRAS)
  Exosomal proteins of breast cancer cells
   100739349 (NRAS)
  Exosomal proteins of colorectal cancer cells
   100739349 (NRAS)
GTP-binding proteins [BR:ssc04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100739349 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N
Other DBs
NCBI-GeneID: 100739349
NCBI-ProteinID: NP_001038002
Ensembl: ENSSSCG00000006753
UniProt: Q2MJK3
LinkDB
Position
4
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggactcttac
cgaaaacaggtggttatagatggtgaaacctgcctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggactgttgacacgaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaaaaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatggggttgccatgtgtggtgatgtaa

DBGET integrated database retrieval system