Sus scrofa (pig): 100739349 Help Entry 100739349         CDS       T01009                                  Gene name NRAS Definition (RefSeq) GTPase NRas precursor   KO K07828   GTPase NRas Organism ssc  Sus scrofa (pig) Pathway ssc01521   EGFR tyrosine kinase inhibitor resistance ssc01522   Endocrine resistance ssc04010   MAPK signaling pathway ssc04012   ErbB signaling pathway ssc04014   Ras signaling pathway ssc04015   Rap1 signaling pathway ssc04062   Chemokine signaling pathway ssc04068   FoxO signaling pathway ssc04071   Sphingolipid signaling pathway ssc04072   Phospholipase D signaling pathway ssc04137   Mitophagy - animal ssc04140   Autophagy - animal ssc04150   mTOR signaling pathway ssc04151   PI3K-Akt signaling pathway ssc04210   Apoptosis ssc04211   Longevity regulating pathway ssc04213   Longevity regulating pathway - multiple species ssc04218   Cellular senescence ssc04360   Axon guidance ssc04370   VEGF signaling pathway ssc04371   Apelin signaling pathway ssc04540   Gap junction ssc04550   Signaling pathways regulating pluripotency of stem cells ssc04625   C-type lectin receptor signaling pathway ssc04650   Natural killer cell mediated cytotoxicity ssc04660   T cell receptor signaling pathway ssc04662   B cell receptor signaling pathway ssc04664   Fc epsilon RI signaling pathway ssc04714   Thermogenesis ssc04720   Long-term potentiation ssc04722   Neurotrophin signaling pathway ssc04725   Cholinergic synapse ssc04726   Serotonergic synapse ssc04730   Long-term depression ssc04810   Regulation of actin cytoskeleton ssc04910   Insulin signaling pathway ssc04912   GnRH signaling pathway ssc04915   Estrogen signaling pathway ssc04916   Melanogenesis ssc04917   Prolactin signaling pathway ssc04919   Thyroid hormone signaling pathway ssc04921   Oxytocin signaling pathway ssc04926   Relaxin signaling pathway ssc04929   GnRH secretion ssc04933   AGE-RAGE signaling pathway in diabetic complications ssc04935   Growth hormone synthesis, secretion and action ssc05010   Alzheimer disease ssc05022   Pathways of neurodegeneration - multiple diseases ssc05034   Alcoholism ssc05160   Hepatitis C ssc05161   Hepatitis B ssc05163   Human cytomegalovirus infection ssc05165   Human papillomavirus infection ssc05166   Human T-cell leukemia virus 1 infection ssc05167   Kaposi sarcoma-associated herpesvirus infection ssc05170   Human immunodeficiency virus 1 infection ssc05200   Pathways in cancer ssc05203   Viral carcinogenesis ssc05205   Proteoglycans in cancer ssc05206   MicroRNAs in cancer ssc05210   Colorectal cancer ssc05211   Renal cell carcinoma ssc05213   Endometrial cancer ssc05214   Glioma ssc05215   Prostate cancer ssc05216   Thyroid cancer ssc05218   Melanoma ssc05219   Bladder cancer ssc05220   Chronic myeloid leukemia ssc05221   Acute myeloid leukemia ssc05223   Non-small cell lung cancer ssc05224   Breast cancer ssc05225   Hepatocellular carcinoma ssc05226   Gastric cancer ssc05230   Central carbon metabolism in cancer ssc05231   Choline metabolism in cancer ssc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100739349 (NRAS)    04012 ErbB signaling pathway     100739349 (NRAS)    04014 Ras signaling pathway     100739349 (NRAS)    04015 Rap1 signaling pathway     100739349 (NRAS)    04370 VEGF signaling pathway     100739349 (NRAS)    04371 Apelin signaling pathway     100739349 (NRAS)    04068 FoxO signaling pathway     100739349 (NRAS)    04072 Phospholipase D signaling pathway     100739349 (NRAS)    04071 Sphingolipid signaling pathway     100739349 (NRAS)    04151 PI3K-Akt signaling pathway     100739349 (NRAS)    04150 mTOR signaling pathway     100739349 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100739349 (NRAS)    04137 Mitophagy - animal     100739349 (NRAS)   09143 Cell growth and death    04210 Apoptosis     100739349 (NRAS)    04218 Cellular senescence     100739349 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     100739349 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     100739349 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100739349 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100739349 (NRAS)    04650 Natural killer cell mediated cytotoxicity     100739349 (NRAS)    04660 T cell receptor signaling pathway     100739349 (NRAS)    04662 B cell receptor signaling pathway     100739349 (NRAS)    04664 Fc epsilon RI signaling pathway     100739349 (NRAS)    04062 Chemokine signaling pathway     100739349 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     100739349 (NRAS)    04929 GnRH secretion     100739349 (NRAS)    04912 GnRH signaling pathway     100739349 (NRAS)    04915 Estrogen signaling pathway     100739349 (NRAS)    04917 Prolactin signaling pathway     100739349 (NRAS)    04921 Oxytocin signaling pathway     100739349 (NRAS)    04926 Relaxin signaling pathway     100739349 (NRAS)    04935 Growth hormone synthesis, secretion and action     100739349 (NRAS)    04919 Thyroid hormone signaling pathway     100739349 (NRAS)    04916 Melanogenesis     100739349 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     100739349 (NRAS)    04726 Serotonergic synapse     100739349 (NRAS)    04720 Long-term potentiation     100739349 (NRAS)    04730 Long-term depression     100739349 (NRAS)    04722 Neurotrophin signaling pathway     100739349 (NRAS)   09158 Development and regeneration    04360 Axon guidance     100739349 (NRAS)   09149 Aging    04211 Longevity regulating pathway     100739349 (NRAS)    04213 Longevity regulating pathway - multiple species     100739349 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     100739349 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100739349 (NRAS)    05206 MicroRNAs in cancer     100739349 (NRAS)    05205 Proteoglycans in cancer     100739349 (NRAS)    05203 Viral carcinogenesis     100739349 (NRAS)    05230 Central carbon metabolism in cancer     100739349 (NRAS)    05231 Choline metabolism in cancer     100739349 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100739349 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     100739349 (NRAS)    05225 Hepatocellular carcinoma     100739349 (NRAS)    05226 Gastric cancer     100739349 (NRAS)    05214 Glioma     100739349 (NRAS)    05216 Thyroid cancer     100739349 (NRAS)    05221 Acute myeloid leukemia     100739349 (NRAS)    05220 Chronic myeloid leukemia     100739349 (NRAS)    05218 Melanoma     100739349 (NRAS)    05211 Renal cell carcinoma     100739349 (NRAS)    05219 Bladder cancer     100739349 (NRAS)    05215 Prostate cancer     100739349 (NRAS)    05213 Endometrial cancer     100739349 (NRAS)    05224 Breast cancer     100739349 (NRAS)    05223 Non-small cell lung cancer     100739349 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     100739349 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     100739349 (NRAS)   09165 Substance dependence    05034 Alcoholism     100739349 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100739349 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100739349 (NRAS)    05170 Human immunodeficiency virus 1 infection     100739349 (NRAS)    05161 Hepatitis B     100739349 (NRAS)    05160 Hepatitis C     100739349 (NRAS)    05163 Human cytomegalovirus infection     100739349 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     100739349 (NRAS)    05165 Human papillomavirus infection     100739349 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100739349 (NRAS)    01522 Endocrine resistance     100739349 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssc04131]     100739349 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssc04147]     100739349 (NRAS)    04031 GTP-binding proteins [BR:ssc04031]     100739349 (NRAS) Membrane trafficking [BR:ssc04131]  Endocytosis   Macropinocytosis    Ras GTPases     100739349 (NRAS) Exosome [BR:ssc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100739349 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    100739349 (NRAS)   Exosomal proteins of breast cancer cells    100739349 (NRAS)   Exosomal proteins of colorectal cancer cells    100739349 (NRAS) GTP-binding proteins [BR:ssc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100739349 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N Motif Other DBs NCBI-GeneID:  100739349 NCBI-ProteinID:  NP_001038002 Ensembl:  ENSSSCG00000006753 UniProt:  Q2MJK3 LinkDB All DBs Position 4 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggactcttac cgaaaacaggtggttatagatggtgaaacctgcctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggactgttgacacgaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaaaaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgtatggggttgccatgtgtggtgatgtaa

DBGET integrated database retrieval system