KEGG   Sus scrofa (pig): 102159722
Entry
102159722         CDS       T01009                                 

Gene name
FHIT
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase isoform X1
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00230  Purine metabolism
ssc01100  Metabolic pathways
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102159722 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102159722 (FHIT)
   05223 Non-small cell lung cancer
    102159722 (FHIT)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     102159722 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 102159722
NCBI-ProteinID: XP_020926413
LinkDB
Position
13
AA seq 220 aa
MTAASRLFLSLGDPGKRSDFDCEKMALRFGQHLIKPSVVFFKTELSFALVNRKPVVPGHV
LVCPLRPVERFRDLRPDEVADLFQVTQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKILK
TTEPGDSQPQDQLVFNRVVLCSHCEQMSTMDMFTSTFFQGRLGTFTGMTASMMSSRNMTE
RMRTPPPYGDQRRIWQQKLQLCGATSSDAGTKGTQTNPKA
NT seq 663 nt   +upstreamnt  +downstreamnt
atgactgcagcttctagactgtttttgtcactgggagatcctggaaagagatcagacttc
gactgtgagaaaatggcactcagattcggccaacatctcatcaagccctctgtggtgttt
ttcaaaacagaactgtcctttgccctggtgaacaggaaacctgtggtcccaggacatgtc
ctggtatgtccccttcggccagtggagcgcttccgagacctgcgacctgatgaagtggcc
gatttgtttcaggtgacccaaagagtcgggacagtggtggagaagcacttccagggcaca
tccctcaccttttccatgcaggatggccccgaagctggacagactgtgaagattttgaag
accaccgaacctggtgacagccaacctcaagatcagttggttttcaatagagttgttctt
tgttctcactgtgaacaaatgtcaacaatggacatgttcacatccacgttcttccaagga
aggctggggactttcacaggaatgacagcatctatgatgagctccagaaacatgacagag
aggatgaggactcccccaccttatggagatcagaggaggatatggcagcagaagctgcag
ctctgcggggctacttccagtgatgcaggcacgaaaggaactcaaacaaatcccaaggca
taa

DBGET integrated database retrieval system