KEGG   Sus scrofa (pig): 102160115Help
Entry
102160115         CDS       T01009                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00052  Galactose metabolism
ssc00500  Starch and sucrose metabolism
ssc01100  Metabolic pathways
ssc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102160115 (MGAM)
   00500 Starch and sucrose metabolism
    102160115 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102160115 (MGAM)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102160115 (MGAM)
    3.2.1.20  alpha-glucosidase
     102160115 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 102160115
NCBI-ProteinID: XP_020934755
LinkDB All DBs
Position
18
AA seq 1826 aa AA seqDB search
MARKKLKKFTDLELMLSVLLLVVFIVTIPLFVLSARESLESKDAGTPGPSTPDSAECAVA
NELERINCIPDQSPTKATCDQRGCCWKPQGAISVPWCYYSTNHGYQVEGDLVNTNAGFTA
QLKRLPSPSLFGNDINNVLLRAEYQTATRFHFKLTDQNQDRYEVPHEHVQPFQGNAASPL
TYEVMVSKQPFSIKVIRTSNSRVLFDSSIGPLLFADQFLQLSIRLPSANVYGLGEHVHQQ
YRHDMNWKTWPIFARDTVPNGDGNNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVALQP
APAVTYRTTGGILDFYVLLGNTPEQVVQEYLQLIGLPALPPYWALGFHLSRYDYETLDNM
REVVERNRAAQLPYDVQHADIDYMDKRRDFTYNPVDFKGFPELAQDLHNNGQKLVIIVDP
AISNDSSPSSPYGPYDRGSDAKIWVNDPDGVTPLIGEVWPGKTVFPDYTNPKCTTWWENE
FKLFHNQVDFDGIWIDMNEVANFVDGSVSGCSTSNLNYPPFTPRILDGYLFSKTLCMDAV
QHWGKQYDVHNLYGYSMAIATAEAVKTVFSNKRSFILTRSTFAGSGKFAAHWLGDNAATW
DDLRWSIPGMLEFNLFGIPMVGSDICGFLLDTSEELCRRWMQVGAFYPFSRNHNGQGYKV
QDPASFGADSLLLNSSRHYLSIRYTLLPYLYTLFYHAHSRGDTVARPLLHEFYEDSNTWD
VYQQFLWGPGLLITPVLDEGAEKVTAYVPDAVWYDYETGGRVTWRKQKVEMELPGDKIGL
HLRGGYIFPTQQPATTTVASRQNPLGLIIALDDNKEAKGELFWDDGEAKDTVANKVYLLY
EFSVTQNRLDVKILQSTYTDPNNLVFKEIKILGTQEPSNVIVKQNDIPVQVSPNVAYDSN
LQVALITEIELELGKNYTVEWDVKIRDEEKIDCYPDETGASEGNCVARGCAWEASTSPGV
PHCYFVDELYSVSDVQYDSFGATAAISLKSSLYASALPSVPVNSLRLSVTYHKENMLQFK
IYDPSNNRYEVPVPLNVPRVPSGTSESRLYDVLIKKNPFGIEIRRKSTGTVIWDSQLLGF
TFNDMFIQISTRLPSQYLYGFGETEHTAFRRNLNWHTWGMFSRDQPPGYKMNSYGVHPYY
MALEEDGNAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVLLGPTPELVTQQYTELI
GRPVMVPYWSLGFQLCRYGYENDSEIASLYEDMVAAQIPYDVQYSDIDYMERQLDFTLSP
KFDGFPALINRMKANGMRVILILDPAISGNETKPYPPFTRGVEDDVFIKYPNDGSIVWGK
VWPDFPDIFVNSSLDWDSQVEQYRAYVAFPDFFRNSTITWWKRELRELYTNPQDPEKSLK
FDGMWIDMNEPSSFVNGAVSPGCRDSSLNHPPYMPYLESRNSGLSSKTLCMEGEQILPDG
SRVRHYDVHSLYGWSQTRPTYEVVQEVTGERGIIISRSTYPSSGRWSGHWLGDNTAAWDQ
LRKSIIGMMEFSLFGISYTGADICGFFQDAEFEMCARWMQLGAFYPFSRNHNSIGTRRQD
PVSWNDTFVNISRSVLETRYTLLPYLYTLMHMAHTEGSTVVRALLHEFVSDRVTWDLDSQ
FLLGPAFLVSPVLEPNARNVTAYFPRARWYDYYTGVDINARGEWRDLSAPLDHINLHIRG
GYILPWQEPAQNTYFSRQKFMGFKVALDDDGTAEGWLFWDDGQSIDTYEQGLYYLANFSV
SQNTMQSHVIFNKYISDANPLKLGYIEIWGVGSAPISSVSISASGEVITPIFIHDSATQV
LNINVTNGNLSLHNFSSLTWTSAPDS
NT seq 5481 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaaaagttcactgatttggagcttatgctcagtgttcttctg
ctcgtagtgtttatcgtcaccatccctctgtttgtactttcagccagagagtctttggaa
tcaaaagatgctggtactccagggccaagtacccctgattcggctgagtgtgccgtggca
aatgagttggaacggataaactgcatccctgaccagtcaccaacaaaggccacttgtgac
cagcgtgggtgctgctggaaacctcagggagccataagtgtgccgtggtgctactattct
acaaatcatggctatcaagtggagggtgaccttgtgaacacaaatgcaggattcacggcc
cagttgaaaaggttgccttctccatccctgtttggaaatgatatcaacaacgtccttctc
agagcagaataccagacagcgactcgtttccactttaagttaactgaccaaaatcaggac
agatatgaagtgcctcatgaacacgtccagcccttccaaggaaatgctgcttctcccttg
acctatgaagtcatggtctccaaacagccctttagcatcaaagtgatcagaacaagcaac
agtcgtgttctgtttgactccagcatcgggccccttctgtttgctgatcagttcctgcag
ctgtccatccgcctgcccagcgctaacgtgtatgggctgggcgagcatgtgcaccagcag
taccggcatgacatgaactggaagacctggcccatatttgccagggacacagtccccaat
ggggatggaaataacttgtacggtgcacagacattcttcttgtgccttgaagatgctagt
ggattgtcctttggagtgtttctcatgaacagcaatgccatggaggtggccctccagccc
gccccagccgtcacctaccgcaccaccgggggcattctcgacttctatgtgctcttggga
aacactccagagcaagtcgttcaagagtacctgcagctcattggactgccagccctgccc
ccgtactgggcactcgggtttcatctcagtcgttacgattatgaaaccctagataacatg
agagaagtcgtggagcgaaaccgtgccgcgcagctcccttatgatgttcagcatgctgat
attgattatatggataagaggagggactttacttataatccagtagatttcaagggcttc
cctgagttggctcaagatttacacaataacggacagaaactggttatcattgtggatcca
gctatttccaatgactcttccccaagtagtccctatggcccatatgaccggggttcagat
gcgaagatatgggtgaatgatccagacggagtgactccactcattggggaggtctggcct
ggaaaaactgtgtttcctgattacaccaaccccaagtgtaccacttggtgggaaaatgaa
tttaaacttttccacaatcaagtagactttgatggaatctggattgatatgaatgaagtc
gccaactttgtggatggttcagtttcaggatgttccacgagcaatctaaattatcctcca
tttactcccaggatcctggatgggtaccttttcagcaagactctctgcatggatgccgtg
cagcactggggcaagcagtatgatgtccacaatctgtatggctactccatggcgatcgcc
acagcagaagctgtcaagactgtgttctctaacaagagaagtttcattctaacccgttcc
acctttgcggggtctggcaagtttgcagcccactggctaggagacaacgcagctacctgg
gatgatctccgatggtccatccctggcatgcttgagttcaacctttttggtatcccaatg
gtgggttctgacatatgcggctttttattggatacttctgaagagctctgcaggaggtgg
atgcaggtgggggctttctatccattttccaggaatcacaacggccaaggctacaaggtc
caggatcctgcctcctttggagctgactctctgctgctgaattcctccaggcactacctc
tccatccgctatactctcttgccctacctctacaccctcttctaccacgctcacagccgg
ggggacacggtggcccggccccttctgcatgagttctatgaggacagcaacacttgggat
gtgtaccagcagtttttatgggggcccggcctcctcattactcctgttctggatgagggt
gcagagaaagtgacggcatatgtgcctgatgctgtctggtatgattatgaaactgggggc
cgagtgacatggaggaagcaaaaagtggagatggagcttcctggagacaaaatcggactt
caccttcgaggaggctacatcttccccacacagcagccagccacgaccactgtggccagt
cgccagaacccgcttggtcttatcattgccctggatgacaacaaagaagccaaaggcgaa
cttttctgggatgacggggaagcgaaagatactgtggccaataaagtttatctcttatat
gagttttctgtcacccaaaaccgcctggatgtgaagattttgcagtcaacctacacagac
cccaataacttagtatttaaagagattaaaatccttgggacccaggaacctagcaacgtt
atagtgaaacaaaatgatatcccagttcaagtttctcctaatgtggcttatgattctaac
ctacaggtggcccttatcacagaaattgaacttgagctgggaaaaaattacacagtggag
tgggatgtgaagataagggatgaagaaaaaatagactgttatcctgatgagacgggtgct
tctgaagggaactgtgttgcccgtggctgcgcctgggaggcatccacttctcctggagtc
cctcattgctattttgtcgatgagctgtactccgtcagtgatgttcagtatgactcattt
ggggccacagctgctatctccttaaagtcttctctgtatgcctccgctttgccctcggta
cccgtgaactccctccgtctgagtgtgacctaccataaggagaacatgctgcagtttaag
atttatgatcccagcaacaaccggtatgaagtgccagttcctctcaatgtacccagggtt
ccatctggcacctctgagagccgcctgtatgatgtcctcattaagaagaatccatttggg
attgaaatccgccggaagagtacaggcaccgtaatttgggactctcagctccttggcttc
accttcaatgacatgttcatccaaatctccacacgcctgccctcccagtacctctacggc
tttggggaaacggagcacacagcctttcgaagaaacttgaactggcacacgtgggggatg
ttttctcgagaccaacccccagggtacaagatgaattcctacggtgttcacccctactac
atggcgctggaggaagacggcaatgcccatggagtgctcctgctgaacagcaacgccatg
gatgtgaccttccagcccttgcctgccttgacttaccgtaccacaggaggaattctggac
ttctatgtgctgttggggccaactccagagcttgtcactcagcagtacactgagttgatc
ggtcggccagtgatggttccttactggtccttgggttttcagctgtgtcgctatggatac
gagaacgactctgagattgccagcttgtatgaggatatggtggctgcccagatcccctat
gacgtgcagtactcggacatcgactacatggagcggcagctggacttcaccctcagcccc
aagtttgatggatttccagctctgattaaccgcatgaaggccaacggcatgcgggtcatc
ctcattctggacccagccatttctggtaacgagacaaaaccctacccgccgttcacgcgg
ggtgtggaagatgatgtcttcatcaaatatccaaatgatgggagcattgtctggggaaag
gtctggcctgattttcctgatatctttgtgaactcatctcttgactgggacagtcaagtg
gagcaataccgagcttacgtggccttcccagactttttccgtaattcgactatcacatgg
tggaagagggaactgagagaactatacaccaatccacaggatcccgagaagagcttgaag
tttgacggcatgtggattgatatgaatgaaccgtcgagttttgtgaatggggcagtttct
ccaggctgcagggacagctctctgaaccaccctccctacatgccatatttggagtccagg
aacagtggcctgagcagcaagaccctgtgcatggagggcgagcagatcttgcctgacggc
tcccgcgtgcggcactacgacgtccacagcctctatgggtggtcccagaccagacccacc
tacgaagttgtgcaggaagtgacgggagagagagggatcatcatctctcgctccacctac
ccctcttctggccgctggtcaggacactggctgggcgacaacacggctgcgtgggaccag
ctgaggaaatctatcatcggcatgatggagtttagcctcttcggcatctcctatacggga
gcagatatctgtggattctttcaagacgctgagtttgaaatgtgtgctcgctggatgcag
ctgggggccttttaccccttctcaaggaaccacaactccattgggaccaggaggcaagac
cctgtgtcctggaatgacacctttgtgaacatctccagaagtgtcctggagaccagatac
accctgttgccgtatctctacaccctgatgcacatggcccacacagagggcagcacagtc
gtgcgggctcttctccatgagtttgtatcagaccgggtaacctgggatttagacagtcag
ttcctgctgggcccagccttcctggtcagccctgtcctggaacctaatgccagaaatgtc
actgcctatttccccagagcccgctggtatgattattacacgggagtggacattaatgcc
cgaggagagtggagggacctgtcagcgcctctggaccacattaatcttcacatccgcgga
ggatacatcctgccctggcaagagcccgcacagaacacctacttcagccgtcagaaattc
atgggcttcaaggttgccttggatgatgatgggaccgctgaaggttggctcttctgggat
gatgggcaaagcattgatacctatgaacaaggactctattacctggccaacttttctgtc
agccagaatacgatgcagagtcatgtaattttcaacaaatacatcagtgatgcaaaccct
ttgaaactgggctacattgagatctggggagtgggcagtgcccccatttccagtgtgagc
atctctgcgagcggcgaggttataacacctatcttcatccacgactctgcaacacaggtg
ttaaacattaacgtgaccaacggaaacctcagcctacataatttcagttccttgacgtgg
acaagtgctccggattcttag

DBGET integrated database retrieval system