KEGG   Sus scrofa (pig): 102164569
Entry
102164569         CDS       T01009                                 

Gene name
NRG1
Definition
(RefSeq) pro-neuregulin-1, membrane-bound isoform isoform X1
  KO
K05455  neuregulin 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04012  ErbB signaling pathway
ssc05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102164569 (NRG1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102164569 (NRG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102164569 (NRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    102164569 (NRG1)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    102164569 (NRG1)
Cytokines and growth factors [BR:ssc04052]
 Growth factors
  Growth factors (RTK binding)
   102164569 (NRG1)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102164569 (NRG1)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set EGF EGF_2 Cyt_b-c1_8 DUF973
Other DBs
NCBI-GeneID: 102164569
NCBI-ProteinID: XP_020932053
LinkDB
Position
15
AA seq 846 aa
MATRPAPRGEDGPRASRSDPAARSPPPPILLLLLWTTALAPGAAAGNEAAPAGASVCYAS
PPSVGSVQELAQRAAVVIEGKVHPARRQQGALDRKAAAAAGEAGAWGGERQPPAAGPGAL
PANNRTVPSWPPAPAPSAAEPGDEAPYLVKVHQVWAVKAGGLKKDSLLTVRLGAWGHPAF
PSCGRLKEDSRYIFFMEPDANSSGRAPAAFRASFPPLETGRNLKKEVSRVLCKRCALPPR
LKEMKSQESAAGSKLVLRCETSSEYSSLKFKWFKNGNELNRKNKPQNIKIQKRPGKSELR
INKASLADSGEYMCKVISKLGNDSASANITIVDSNEIITGMPASTERAYVSSESPIRISV
STEGANTSSSTSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTG
DRCQNYVMASFYKHLGIEFMEAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKK
LHDRLRQSLRSERNNMVNIANGPHHPNPPPENVQLVNQYVSKNVISSEHIVEREAETSFS
TSHYTSTAHHSTTVTQTPSHSWSNGHTESILSESHSVIMMSSVENSRHSSPTGGPRGRLN
GLGGPRECNSFLRHARETPDSYRDSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMS
PPMSSTTVSMPSMAISPFVEEERPLLLVTPPRLREKYDHHSQQFSSAHCNPAHESNSLPP
SPLRIVEDEEYETTQEYEPAQEPDKKLTNSRRAKRTKPNGHIANRSEMDSNTSAESSNSE
SETEDERVGEDTPFLGIQNPLAASLEVAPAFRLADGRTNPAGRFSPQEELQARLSSVIAN
QDPIAV
NT seq 2541 nt   +upstreamnt  +downstreamnt
atggcgacgcgccccgcgccgcgcggggaggacggcccccgggcctcgcgctccgacccc
gcagcccgctcgcctccgccgccgatactgttgctgctgctgtggaccacggccctggcg
ccgggggcggccgccggcaacgaggcggctcccgcgggggcttcagtgtgctacgcgtcc
ccgcccagcgtgggctcggtgcaggagctggctcagcgcgccgcggtggtgatcgaggga
aaggtgcacccggcgcggcggcagcagggggcactcgacaggaaggcggcggcggcggcg
ggcgaggcaggggcgtggggcggcgagcgccagccgcccgccgcgggcccgggagcgctg
cccgcgaacaaccggactgtgccctcctggcccccggccccggcgcccagtgccgccgag
cccggagacgaggcgccctatctggtgaaggtgcaccaggtgtgggcggtgaaagccggg
ggcctgaagaaagactcgctgctcaccgtgcgcctgggcgcctggggtcaccccgcgttc
ccctcctgcgggcgactcaaggaggacagcaggtacatctttttcatggagcccgacgcc
aacagcagcggccgcgcaccggctgccttccgagcatcctttccccctctagagacgggc
cggaacctcaagaaggaggtcagccgggtgctgtgcaagcggtgcgccttgcctccccga
ttgaaagagatgaaaagtcaagagtccgctgcaggctccaaactagtgcttcggtgtgag
accagttctgagtactcctctctcaaattcaaatggttcaagaatgggaatgagttaaac
cgaaagaacaagccacaaaacattaagatacaaaaaagaccagggaagtctgaacttcgc
attaacaaagcatcactggctgattctggagaatatatgtgcaaagtgatcagcaagtta
ggaaatgacagtgcctctgccaatatcaccatcgtggactcaaatgagatcatcactggc
atgccagcctcaactgaaagagcatatgtgtcttcagagtctcccattagaatatcagta
tcaacagaaggagcaaatacttcttcctccacatcaacatctacaactgggacaagccat
cttgtcaagtgtgcagagaaggagaaaactttctgtgtgaacggaggcgagtgcttcatg
gtgaaagacctttcaaacccctcaagatacttgtgcaagtgcccaaatgagtttactggt
gatcgctgccaaaactacgtaatggccagcttctacaagcatcttgggattgaatttatg
gaagcggaggagctctaccagaagcgagtgctgaccatcactggcatctgcatcgccctg
ctcgtggtcggcatcatgtgtgtggtggcctactgcaaaaccaagaagcagcgaaaaaag
cttcacgaccgacttcggcagagtcttcggtctgaacgaaacaacatggtgaacatagcc
aacggacctcaccaccctaatccaccccctgagaacgtccagctggtgaatcaatacgtg
tctaaaaatgtcatctctagtgagcatatcgtcgagagagaggcagagacatctttttcc
accagtcactacacttcaacagctcatcactccacgaccgtcacccagactcccagtcac
agctggagcaatggacacacagaaagcatcctttcagaaagccactctgtaatcatgatg
tcatcagtagaaaatagtaggcacagcagccccactgggggcccaagaggacgtcttaat
ggcttgggaggccctcgagaatgtaacagcttcctcaggcatgccagagaaacccctgac
tcctaccgagactctcctcatagtgaaaggtatgtgtcagccatgaccaccccggctcgt
atgtcacctgtagatttccacacgccaagctcccccaaatcgcccccttcggaaatgtct
ccacccatgtcgagcacgacggtgtccatgccctccatggccatcagcccctttgtggaa
gaagagagacccctgcttctcgtgacaccgccacgcctgcgggagaaatatgaccaccac
tctcagcagttcagctccgcccattgcaaccccgcgcatgagagcaacagcctgcctccc
agccccttaaggatagtggaggatgaggaatatgaaaccacccaggagtatgaaccggct
caggagcctgataagaaactcaccaacagccggcgggccaaaagaaccaagcccaatggc
cacattgccaacaggtccgaaatggacagcaacacaagcgctgagagcagtaactcagag
agcgagacggaagatgagcgagtcggggaagatacacccttcctgggcatacagaacccc
ctggcagccagccttgaggtggcacctgccttccggctggctgacggcaggactaaccca
gcaggtcgcttctctccacaggaagaattgcaagcccggctgtccagtgtaatcgctaac
caagaccctattgctgtataa

DBGET integrated database retrieval system