KEGG   Sus scrofa (pig): 102167153
Entry
102167153         CDS       T01009                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04012  ErbB signaling pathway
ssc04062  Chemokine signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04360  Axon guidance
ssc04370  VEGF signaling pathway
ssc04510  Focal adhesion
ssc04670  Leukocyte transendothelial migration
ssc04810  Regulation of actin cytoskeleton
ssc04935  Growth hormone synthesis, secretion and action
ssc05100  Bacterial invasion of epithelial cells
ssc05135  Yersinia infection
ssc05146  Amoebiasis
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05205  Proteoglycans in cancer
ssc05222  Small cell lung cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102167153 (PTK2)
   04370 VEGF signaling pathway
    102167153 (PTK2)
   04151 PI3K-Akt signaling pathway
    102167153 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102167153 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102167153 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102167153 (PTK2)
   04062 Chemokine signaling pathway
    102167153 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102167153 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    102167153 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102167153 (PTK2)
   05202 Transcriptional misregulation in cancer
    102167153 (PTK2)
   05205 Proteoglycans in cancer
    102167153 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102167153 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102167153 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102167153 (PTK2)
   05100 Bacterial invasion of epithelial cells
    102167153 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102167153 (PTK2)
   05163 Human cytomegalovirus infection
    102167153 (PTK2)
   05165 Human papillomavirus infection
    102167153 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102167153 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102167153 (PTK2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102167153 (PTK2)
Protein kinases [BR:ssc01001]
 Non-receptor tyrosine kinases
  FAK family
   102167153 (PTK2)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102167153 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 102167153
NCBI-ProteinID: XP_020944479
Ensembl: ENSSSCG00000026625
Vega: OTTSUSG00000000682
LinkDB
Position
4
AA seq 1122 aa
MEKSRCSPFPVCWAKEYDRYLASSKIMAAAYLDPNLNHTPNSSTKTHLGTGVERSPGAMD
RVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEE
VHWLHLDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSD
YMLEIADQVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPRSLLDS
VKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAI
GPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGTLQLKIAGAPEPLTVTAPSL
TIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLANSEKQGVRTHAVSVSGV
SHCHHKVKKARRFLPLVFCSHEPPSTDEISGDETDDYAEIIDEEDTYTMPSKSYGIDEAR
DYEIQRERIELGRCIGEGQFGDVHQGAYTSPENPALAVAIKTCKNCTSDSVREKFLQEAL
TMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTA
LAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPES
INFRRFTSASDVWMFGVCMWEILMLGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYS
LMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQVAVSWDSGGSDEAPP
KPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGPHGVTAMAGSIYPGQASLLDQTDS
WSQRPQEMSVWQPSVEDSTALDLRGLGQVLPAHLMEERLIRQQQEMEEDQRWLEKEERFL
KPDVRLSRGSIDREDGGLQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLASLGSLGS
PGDSYNEGVKPWRLQPQEISPPPTANLDRSNDRVYENVTGLVRAVIEMSSKIQPAPPEEY
VPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMT
SLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKVLGQARPH
NT seq 3369 nt   +upstreamnt  +downstreamnt
atggagaagagccgctgtagtccgtttccagtgtgttgggccaaagaatatgacagatac
ctagcatctagcaaaataatggcagctgcttaccttgacccaaacttgaatcacacaccg
aattcaagtaccaagactcacctgggcaccggtgtggaacgttcccccggggcgatggat
cgagtgttgaaggtctttcattattttgaaagcaacagtgagccaaccacctgggccagt
attatcaggcatggggatgctactgacgtcaggggcatcattcagaagatagtggacagt
cacaaagtaaagcacgtggcctgctatggatttcgcctgagtcacctgcggtcagaggag
gtgcactggctccatttggatatgggtgtctccagtgtgagggagaagtatgaacttgca
cacccaccagaggagtggaaatacgaattgagaattcgttatttgccaaaaggatttcta
aaccagtttactgaggacaagccaactctgaatttcttctatcaacaggtgaagagtgat
tatatgttagagatcgctgaccaagtggaccaggacattgctttgaagctgggttgtctg
gagatacggcgctcatactgggagatgcggggcaacgccctggagaagaagtctaactac
gaagttctggaaaaagatgttggtttgaagcgattttttcctaggagtttactggattct
gtcaaggccaaaacactaagaaagttgatccagcaaacgtttagacagttcgccaacctc
aacagagaagaaagtattttgaaattctttgagatcctctccccggtgtacagatttgac
aaagaatgcttcaagtgtgccctcgggtcaagctggattatttcggtggagctggcgatt
ggccccgaagaaggaatcagttacctcacggacaagggctgcaaccccacacatctggcc
gacttcaaccaagtgcagaccattcagtattccaacagcgaagacaaggaccggaaagga
actctgcagctgaagatcgcgggcgcgcccgagcctctgacggtgacagcgccgtccctg
accatcgccgagaacatggccgacctgatcgacggctactgccggctggtgaacggagcc
acgcagtctttcatcatcaggccccagaaagaaggtgaacgagctttgccatcgatacca
aagctggccaacagcgagaagcaaggtgtgcggacccacgcggtctctgtgtcaggagtc
agtcactgccaccataaagttaagaaagctaggcgctttctccctttggtcttctgttcc
catgagcctccttctacggatgaaattagtggggacgaaacagacgattatgcggagatc
atagatgaagaagatacttacaccatgccctcgaaaagctatggaatagatgaagccagg
gactatgagattcagagggagaggatagagctcggacggtgcattggagagggccagttt
ggggacgtgcaccaaggcgcttacacgagcccagagaacccagctttggcggttgcaatt
aaaacatgtaaaaactgtacttcggacagcgtgagagagaaattccttcaggaagccttg
acgatgcgtcagtttgaccacccgcacatcgtgaagctgatcggggtcatcacggagaac
cccgtctggatcatcatggagctgtgcacgcttggagagctgaggtcgtttctgcaagta
aggaagtacagtttggatctagcatctctgatcctgtacgcctatcagcttagcacagcc
ctcgcgtatctagagagcaaaagattcgtgcacagggacattgctgctcggaatgttctc
gtatcctcaaatgactgcgtaaaattgggagactttggcttatcccgatacatggaagac
agtacttactacaaagcttccaaaggaaaactgcctattaagtggatggctccggagtcc
atcaattttcgacggtttacctcagctagtgacgtgtggatgtttggtgtgtgcatgtgg
gagatactgatgctcggcgtgaagcccttccaaggcgtgaagaacaatgacgtcatcggc
cgcattgagaacggcgagcggctgcccatgcctcccaactgccctcccaccctctacagc
ctcatgaccaagtgctgggcctacgaccccagccggcggccccgcttcacggagctcaaa
gctcagctcagcaccatcctggaggaagagaaggtgcagcaggaagagcggatgaggatg
gagtccagacgacaggtcgcagtgtcctgggactccggagggtccgacgaagcgccgccc
aagcccagcagacccggttatcctagtccaaggtccagtgaaggattttatcccagccca
cagcacatggtacaaaccaatcattaccaggtctctggctacccgggtcctcatggagtc
acagccatggctggcagcatctacccaggtcaggcgtctcttttggaccagacagattca
tggagtcagagaccacaggagatgtcagtgtggcagcccagcgtggaggactccacagcc
ctggacctgcgcggcctcgggcaggtgttgcccgcccacctgatggaagagcggctgatc
cggcagcagcaggagatggaggaagatcagcgctggctggagaaggaggagaggtttctg
aaacctgacgtgcggctttctcgaggcagcatcgacagggaagacggaggtcttcagggc
ccgactggaaaccaacacatatatcagcctgtgggcaaaccagatcctgcagctccacca
aagaaacctccacgtccgggagcccccgggcacctcgccagcctcggcagcctcggcagc
cccggggacagttacaacgagggtgtcaagccctggaggctgcagccccaggaaatcagc
cctcctcccactgccaacctggaccggtccaatgacagggtgtacgagaacgtgacgggc
ctggtgagggcggtcatcgagatgtccagcaagatccagccggccccgccggaggagtac
gtgcccatggtgaaggaggtcggcctggccctgaggacgctcttggccactgtggacgag
accattcctgtcctgccagctagcacacaccgagagatcgagatggcccagaagctgctg
aactcagacctgggcgagctcatcagcaagatgaagctggcgcagcagtacgtcatgacc
agcctgcagcaggagtacaagaagcagatgctgacggctgcgcacgccctggccgtggac
gccaaaaacctgctggacgtcatcgaccaggcccggctgaaggtgctgggccaggcgagg
ccgcactga

DBGET integrated database retrieval system