KEGG   Sus scrofa (pig): 110256598
Entry
110256598         CDS       T01009                                 

Gene name
FRAT1
Definition
(RefSeq) proto-oncogene FRAT1
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05200  Pathways in cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110256598 (FRAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110256598 (FRAT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110256598 (FRAT1)
   05226 Gastric cancer
    110256598 (FRAT1)
   05224 Breast cancer
    110256598 (FRAT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110256598 (FRAT1)
   05022 Pathways of neurodegeneration - multiple diseases
    110256598 (FRAT1)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 110256598
NCBI-ProteinID: XP_020927987
LinkDB
Position
14
AA seq 279 aa
MPCRREEEEEAGEEEEEEEEEEDSVLLLEQSVTLGGSGEVDRLVAQIGETLQLDAAQDRP
ASPGAPPGPPLQPPRPLAAVRAEKALATALPPLLPPGSAEAGGPAPPGALRCPLGDRGRV
RGRTAPYFVAELATGPSALSPLPTQLSLDGPSGAVKRGAPQPLSGPRRRGWLRGAAASRR
LQQRRGPQPQARTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLHAKLPQRPLLGPLS
APVHEPPSPRSPRAACSDPGASGRRTQLRTGDGVLVPGS
NT seq 840 nt   +upstreamnt  +downstreamnt
atgccgtgccggagagaggaggaagaggaagccggcgaggaagaggaggaggaggaggag
gaggaggacagcgtcctcctactggaacagtcggtgacgctgggcggctcgggcgaggtg
gaccggctggtggcccagatcggcgagacgctgcagctggacgccgcacaggaccgccct
gcctccccgggcgctcccccgggaccgccgctgcagcccccgcggcccctggcagccgtg
agagcggagaaggccctggccacagctctgccgccgcttctgccgcccgggtcggcggag
gctgggggcccggcgcccccgggggccctgcgctgccccctcggggatcgcggccgcgtg
cggggccggactgctccctactttgtggccgagcttgccacaggccccagcgctctgtcc
ccattgcccactcagcttagccttgatggaccctcaggagcggtcaagcggggtgccccg
cagccgctgtcgggcccacgccggcgaggatggctgcggggtgccgccgcctcccgccgc
ctgcagcagcgacgtgggccccagcctcaagctcgcaccggcgatgatgacccgcaccgg
cttctgcagcagctcgtactctcggggaatctcatcaaggaggcggtgcggaggcttcat
tcgcgacggctgcagttacacgcaaagcttccccaacgcccgctccttggccctctgtcg
gccccggtgcatgagcccccttcgccccgcagccctcgcgcggcctgcagcgaccctggc
gcgtccgggaggaggacacagctcagaactggcgacggcgttctagtccccggcagctaa

KEGG   Sus scrofa (pig): 110256599
Entry
110256599         CDS       T01009                                 

Gene name
FRAT2
Definition
(RefSeq) GSK-3-binding protein FRAT2
  KO
K03096  frequently rearranged in advanced T-cell lymphomas 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05200  Pathways in cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110256599 (FRAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110256599 (FRAT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110256599 (FRAT2)
   05226 Gastric cancer
    110256599 (FRAT2)
   05224 Breast cancer
    110256599 (FRAT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110256599 (FRAT2)
   05022 Pathways of neurodegeneration - multiple diseases
    110256599 (FRAT2)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 110256599
NCBI-ProteinID: XP_020927988
LinkDB
Position
14
AA seq 228 aa
MPCWREEEVEAGEEEEEEDSFLLLEQSVTLGGSGEVDRLVAQIGETLQLDAAQDRPVSPC
ALPGPPLQPPRPPAAVLAEKARAPALPLLLPPGSAEARGPGPLGALRCPFGDRGRVRNRT
APYFVAELAAGPNALPGPCRRGWLRSAVASRRLQQRPWPPAGARANDDDPHRLLQQLVLS
GNLIKEAVRRLQRAVAAVAATGPTGGPGAGSSCSRPDPVALQPSGALH
NT seq 687 nt   +upstreamnt  +downstreamnt
atgccgtgctggagggaggaggaagtggaagccggcgaggaagaggaggaggaagacagc
ttcctcctgctggaacagtcggtgacgctgggcggctccggcgaggtggaccggctggta
gcccagatcggcgagacgctgcagttggacgcggcacaggaccgccctgtgtccccgtgc
gcgctcccgggaccgccgctgcagcccccgcggccgccggcagcagtgctagcggaaaag
gcccgggccccagctctgccgctgcttctgccgcccgggtctgcggaggctaggggtccc
gggcccctaggggctctgcgctgccccttcggggatcgcggccgcgtgcggaaccggact
gcgccctactttgtggccgagcttgccgcaggccccaacgccctgcctgggccgtgccgg
cgtggatggcttcggagcgctgtcgcctcccgccgcctgcaacagcgcccatggccccca
gctggggcgcgcgccaacgacgacgacccgcaccgactcctgcagcagttggtgctttcg
gggaacctcatcaaggaggccgtgcggaggctccagcgagcggtcgcagcggttgcagcc
acaggccccacgggcggccccggagctgggagcagctgtagcagaccggaccctgtcgct
ctgcagccctccggcgccttgcactga

DBGET integrated database retrieval system