KEGG   Sus scrofa (pig): 110259215Help
Entry
110259215         CDS       T01009                                 

Gene name
LSP1
Definition
(RefSeq) lymphocyte-specific protein 1 isoform X1
  KO
K14957  lymphocyte-specific protein 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04625  C-type lectin receptor signaling pathway
ssc05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110259215 (LSP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110259215 (LSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon
Motif
Other DBs
NCBI-GeneID: 110259215
NCBI-ProteinID: XP_020938259
LinkDB All DBs
Position
2
AA seq 469 aa AA seqDB search
MAEAPSHPDSEEQQELLVEEGSGLAAQWSLEDEEEAARERRRRERDRQLQGQDEDEGGPG
PEQQEQEKLLKPPDAPELDEDEGFGDWSQKPEQRRQPWGPGETSDSGDPLQGESPEGEQE
EDRQVGGRSGGGGSLQAPDGVPPTPWAPPPRSPPKCPLAEGAGGRARDGGRGGEGSHSWA
PQGPGPLPDQLWRPGGCYISTHLQPADVREALGPPPPLPPPPPLPPSGRPSSIPTEGSRP
GQHVCGSPARVCLEELCLSPDSELQEELGSEASEPRGPAGPVQGSPGLAETEEGDVQPQR
CQQPRTPSPSVLEGTAPGSPPLSPSTKLIDRTESLHRSIQKSNSVKKSQPALPISKIDGR
LEQYTQAIETAGRAHKLTRQPSIELPSMAVASTKSRWETGEVQAQSAAKPPSCKDIVAGD
MSKKSLWEQKGGPKTSSTVKSTPSGKRYKFVAAGHGKYEKVLVDEGSVP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcgcccagccaccccgactctgaggagcagcaggagctgctggtggaagaa
ggctcagggctcgccgctcagtggagcctggaggatgaggaggaggccgcccgggagcgg
cgccggcgcgagagggacaggcagcttcagggccaggacgaggatgaaggcggcccgggc
ccggagcagcaggagcaggagaagctcctgaagccccccgacgcccccgagctggatgag
gatgaaggtttcggcgactggtcccagaagccggagcagcggcggcagccctgggggccc
ggggagacctcggacagcggggacccccttcagggcgagagtccggaaggggagcaggag
gaggacaggcaagtggggggccggagtggaggcgggggctctctccaggccccggacggg
gtccccccaacgccctgggctccccctccccgcagccccccgaagtgccccctggctgag
ggggcaggaggaagagcacgagacggcgggcggggtggggagggctctcattcctgggct
ccccagggccccgggccccttccagaccagctgtggcggccagggggctgctacatcagc
acacatctgcagcccgctgacgtcagggaggcgctcggcccgccgccgccgctgccgccg
ccgccgccccttcctccctcggggcggcccagctccattcccacggaggggagcaggccc
ggccagcacgtctgtgggagcccagcccgggtgtgtctggaggagctgtgcctgagcccc
gactcagagcttcaggaagagctgggatcagaggcctcagagcccagaggccccgcggga
cccgtgcagggcagcccaggcctggcagagacagaggagggggacgtgcagccccagaga
tgccagcagccccggacccccagcccctctgtcttggaggggaccgcaccgggctcccct
cccctgagccccagcaccaaactcatcgacagaaccgagtccctgcaccgctccattcag
aagagcaacagtgtgaagaagtcccagccagccctgcccatctccaagattgacgggcgc
ctggagcaatacacccaggccatcgagactgctggccgggcccacaagctgacccgccag
ccgtctattgagctgcccagcatggccgtggcgagcaccaagagccggtgggagacgggc
gaggtgcaggctcagtccgccgccaagcccccctcctgcaaggatattgttgctggagac
atgagcaagaagagcctctgggagcagaaagggggccccaagacttcgtcgacggttaag
agcaccccatctgggaagaggtacaaattcgtggccgccggacacgggaagtacgagaag
gtgcttgtggacgaaggctccgtgccctaa

DBGET integrated database retrieval system