KEGG   Sus scrofa (pig): 110261054Help
Entry
110261054         CDS       T01009                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110261054 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    110261054 (KMT5C)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110261054 (KMT5C)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110261054 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 110261054
NCBI-ProteinID: XP_020950664
LinkDB All DBs
Position
6
AA seq 525 aa AA seqDB search
MRRPKGLPASRRVYKWHRAGTRPGRRPCPCAALSTPRRRQHGAWGTMGPDRVTARELCEN
DDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRDLEAAYRALTLGGWM
AHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEK
LELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPA
DGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERWGQPAVRDKGPWAPRTWQ
CLLRAHPLSLLTPPQERRRCLQTAAPGAPATPAPGQVRAPGDQAAAAAGPGRPPGLRPPR
PAAPGPLLCCLPAPVPPALRCPPRCRTPLAPVAASAPAPGAPQKAPTPQAPASPGTPRSP
CCPCLSTPVGRLWPPLLPAGGGPGGPRSGLPSPLGPPAGLALGPALWAALRGPGGPEPHG
LSLACHCHTRPCQDPRPHPHPQAGPCLHPLLPTQAPAAGGQPRLH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaccgaagggtttgccagcgtcgcgcagagtgtacaagtggcacagagcaggc
acgcgcccagggcgccgtccctgcccctgcgctgccctctccactccccgccggagacag
catggtgcgtggggcaccatggggcccgaccgcgtgaccgccagggaactgtgtgagaac
gacgaccttgccaccagcctcgtcctggacccctacctcggcttccgcacccataagatg
aacgtcagccccgtgccccccctgcggcgacagcaccacctgcgctcagcgctggaggcc
ttcctgaggcagcgggacctggaggctgcgtaccgggccctgacgctgggaggctggatg
gcccactacttccagagccggggcccgcggcaggaggctgccctcaagacccacatctat
cgctacctccgcgccttcctgcctgagagtggctttaccatcttgccctgtacccgttat
tccatggagacgaacggagccaagattgtgtccacccgagcttggaaaaagaatgagaag
ctggagctgctggtgggctgcatcgcggagctgcgggaggccgacgaggggctgctgagg
gccggcgagaacgacttcagcatcatgtactcaacccgaaagcgcagcgctcagctgtgg
ctcggcccggccgccttcatcaaccacgactgcaaacccaactgcaagtttgtacctgca
gatgggaacgcagcctgcgtgaaggtgctgcgggacatcgagccaggcgacgaggtaacc
tgcttctacggcgaaggcttctttggtgaaaagaacgagcactgtgaatgctacacctgt
gagaggtggggacagcctgcggtaagggacaagggcccctgggctcccaggacctggcag
tgcctcctcagggcccatcccctctccctgctcacccccccccaggagaggcgaaggtgc
cttcagactgcggccccgggagcccctgccacccccgcccctggacaagtacgagctccg
ggagaccaagcggcggctgcagcggggcctggacggccaccgggcctccgcccaccccgc
cccgctgcgccgggaccccttctgtgctgcctgccagcccctgtgccccccgcccttcgc
tgcccgccccgatgccgcacccctctggctccagtggctgcctcagccccagctccgggt
gcgccccagaaggcgccgacgccccaagccccggcgagccccggcaccccccgttctccg
tgctgcccgtgtctctctacaccggtggggaggctgtggcccccactgctgcctgcaggc
ggaggccctggtggccctaggtccggcctcccgagcccgctgggtcccccagcaggactg
gcactgggcccggcgttatgggctgccttacgtggtccgggtggacctgagccgcatggc
ctcagcctcgcctgccactgccacacccgcccctgccaggaccccaggccccatccccat
ccccaagcaggcccttgccttcacccccttctccccacccaagcgcctgcggctggtggt
cagccacggctccattga

DBGET integrated database retrieval system